Gene/Proteome Database (LMPD)

LMPD ID
LMP010559
Gene ID
816619
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lipoic acid synthase 1
Gene Symbol
LIP1
Synonyms
F5H14.17; F5H14_17; LIP1; lipoic acid synthase 1
Alternate Names
lipoic acid synthase 1
Chromosome
2
EC Number
2.8.1.8
Summary
LIP1,Lipoic acid synthase
Orthologs
View orthologs and multiple alignments for LIP1

Proteins

lipoic acid synthase 1
Refseq ID NP_179682
Protein GI 15226412
UniProt ID Q9ZWT1
mRNA ID NM_127655
Length 374
RefSeq Status REVIEWED
MHSRSALLYRFLRPASRCFSSSSAVTPVTVTQSPKSLEALRARLANESPSLTDFIHGDTYSVEVGTKKKPLPKPKWMKESIPGGERYVQIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDPNEPNNVAEAIASWGVDYVVITSVDRDDLPDQGSGHFAETVQRLKFLKPEMLIEALVPDFRGDGGCVEKVSKSGLDVLAHNIETVEELQSFVRDHRANFKQSLDVLRMAKEYAPAGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPDAFERYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVASPSTSP

Gene Information

Entrez Gene ID
816619
Gene Name
lipoic acid synthase 1
Gene Symbol
LIP1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005759 IDA:TAIR C mitochondrial matrix
GO:0051539 IEA:UniProtKB-HAMAP F 4 iron, 4 sulfur cluster binding
GO:0016992 IGI:TAIR F lipoate synthase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0006546 TAS:TAIR P glycine catabolic process
GO:0009249 IEA:UniProtKB-HAMAP P protein lipoylation

KEGG Pathway Links

KEGG Pathway ID Description
ath00785 Lipoic acid metabolism
ko00785 Lipoic acid metabolism
ath01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR013785 Aldolase-type TIM barrel
IPR006638 Elongator protein 3/MiaB/NifB
IPR003698 Lipoyl synthase
IPR027527 Lipoyl synthase, mitochondrial
IPR007197 Radical SAM

UniProt Annotations

Entry Information

Gene Name
lipoic acid synthase 1
Protein Entry
LIAS_ARATH
UniProt ID
Q9ZWT1
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Protein N(6)-(octanoyl)lysine + 2 sulfur- (sulfur carrier) + 2 S-adenosyl-L-methionine = protein N(6)- (lipoyl)lysine + 2 (sulfur carrier) + 2 L-methionine + 2 5'- deoxyadenosine. {ECO:0000255|HAMAP-Rule:MF_03128}.
Cofactor Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883; Evidence={ECO:0000255|HAMAP-Rule:MF_03128}; Note=Binds 2 [4Fe-4S] clusters per subunit. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L- methionine. {ECO:0000255|HAMAP-Rule:MF_03128};
Function Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives. {ECO:0000255|HAMAP-Rule:MF_03128, ECO:0000269|PubMed:9808738}.
Pathway Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 2/2. {ECO:0000255|HAMAP-Rule:MF_03128}.
Similarity Belongs to the radical SAM superfamily. Lipoyl synthase family. {ECO:0000255|HAMAP-Rule:MF_03128}.
Subcellular Location Mitochondrion {ECO:0000255|HAMAP- Rule:MF_03128, ECO:0000269|PubMed:9808738}.
Tissue Specificity Expressed in leaves and flowers, but not in roots. {ECO:0000269|PubMed:9808738}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010559 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15226412 RefSeq NP_179682 374 lipoic acid synthase 1

Identical Sequences to LMP010559 proteins

Reference Database Accession Length Protein Name
GI:15226412 EMBL CBM36048.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15226412 EMBL CBN72405.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15226412 GenBank AAL15183.1 374 putative lipoic acid synthase LIP1 [Arabidopsis thaliana]
GI:15226412 GenBank ACX19768.1 374 Sequence 48064 from patent US 7569389
GI:15226412 GenBank AEC07088.1 374 lipoic acid synthase 1 [Arabidopsis thaliana]
GI:15226412 SwissProt Q9ZWT1.1 374 RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010559 proteins

Reference Database Accession Length Protein Name
GI:15226412 GenBank EFH60487.1 374 hypothetical protein ARALYDRAFT_900465 [Arabidopsis lyrata subsp. lyrata]
GI:15226412 GenBank ESQ50477.1 373 hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum]
GI:15226412 RefSeq XP_002884228.1 374 hypothetical protein ARALYDRAFT_900465 [Arabidopsis lyrata subsp. lyrata]
GI:15226412 RefSeq XP_006409024.1 373 hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum]
GI:15226412 RefSeq XP_010467759.1 372 PREDICTED: lipoyl synthase, mitochondrial [Camelina sativa]
GI:15226412 RefSeq XP_010488982.1 372 PREDICTED: lipoyl synthase, mitochondrial-like [Camelina sativa]