Gene/Proteome Database (LMPD)

LMPD ID
LMP010547
Gene ID
831801
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lipid phosphate phosphatase gamma
Gene Symbol
AT5G03080
Synonyms
F15A17.110; F15A17_110
Alternate Names
lipid phosphate phosphatase gamma
Chromosome
5
EC Number
3.1.3.-

Proteins

lipid phosphate phosphatase gamma
Refseq ID NP_195928
Protein GI 15242619
UniProt ID Q6NLA5
mRNA ID NM_120386
Length 226
RefSeq Status REVIEWED
MDLIPQQLKAVTLTHVRYRPGDQLGHFLAWISLVPVFISLGGFVSHFLFRRELQGIFFGIGLVISQFINEFIKTSVEQARPETCTLLEACDSHGWPSSHSQFMFFFATYFSLMGCKGIGFWFGLRSRWIMNLLHWSLAVVTMYSRVYLGYHTVAQVFAGAALGGIVGASWFWVVNSVLYPFFPVIEESVLGRWLYVKDTSHIPDVLKFEYDNARAARKDMDSAKSD

Gene Information

Entrez Gene ID
831801
Gene Name
lipid phosphate phosphatase gamma
Gene Symbol
AT5G03080
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009528 IEA:UniProtKB-KW C plastid inner membrane
GO:0008195 IDA:TAIR F phosphatidate phosphatase activity
GO:0016311 IDA:GOC P dephosphorylation
GO:0006651 IDA:TAIR P diacylglycerol biosynthetic process
GO:0048868 IMP:TAIR P pollen tube development

KEGG Pathway Links

KEGG Pathway ID Description
ath00510 N-Glycan biosynthesis
ko00510 N-Glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254037 Synthesis of Dolichyl-phosphate
6254038 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
lipid phosphate phosphatase gamma
Protein Entry
LPPG_ARATH
UniProt ID
Q6NLA5
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimum pH is 6.0-8.0. {ECO:0000269|PubMed:17652095};
Disruption Phenotype Lethal effect when homozygous, due to defect in pollen germination and pollen tube growth. {ECO:0000269|PubMed:17652095}.
Enzyme Regulation Inhibited by Mg(2+). {ECO:0000269|PubMed:17652095}.
Function Exhibits phosphatidate phosphatase (PAP) activity in vitro. May play a primary role as PAP in plastids. {ECO:0000269|PubMed:17652095}.
Sequence Caution Sequence=CAB86075.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the PA-phosphatase related phosphoesterase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast inner membrane {ECO:0000305|PubMed:17652095}; Multi-pass membrane protein {ECO:0000305|PubMed:17652095}.
Tissue Specificity Expressed in root tips, root branch points, vascular tissue of cotyledons and leaves, pistil, anthers and filaments. {ECO:0000269|PubMed:17652095}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010547 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15242619 RefSeq NP_195928 226 lipid phosphate phosphatase gamma

Identical Sequences to LMP010547 proteins

Reference Database Accession Length Protein Name
GI:15242619 DBBJ BAF00841.1 226 hypothetical protein [Arabidopsis thaliana]
GI:15242619 GenBank AAR23728.1 226 At5g03080 [Arabidopsis thaliana]
GI:15242619 GenBank AAS92345.1 226 At5g03080 [Arabidopsis thaliana]
GI:15242619 GenBank ACW85423.1 226 Sequence 1376 from patent US 7569389
GI:15242619 gnl TAIR 226 lipid phosphate phosphatase gamma [Arabidopsis thaliana]
GI:15242619 SwissProt Q6NLA5.1 226 RecName: Full=Lipid phosphate phosphatase gamma, chloroplastic; Short=AtLPPG; AltName: Full=Phosphatidic acid phosphatase gamma; AltName: Full=Plastidic phosphatidic acid phosphatase gamma; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010547 proteins

Reference Database Accession Length Protein Name
GI:15242619 EMBL CAB86075.1 268 putative protein [Arabidopsis thaliana]
GI:15242619 GenBank EOA21503.1 226 hypothetical protein CARUB_v10001899mg [Capsella rubella]
GI:15242619 RefSeq XP_006288605.1 226 hypothetical protein CARUB_v10001899mg [Capsella rubella]
GI:15242619 RefSeq XP_010423778.1 226 PREDICTED: lipid phosphate phosphatase gamma, chloroplastic [Camelina sativa]
GI:15242619 RefSeq XP_010452170.1 226 PREDICTED: lipid phosphate phosphatase gamma, chloroplastic-like [Camelina sativa]
GI:15242619 RefSeq XP_010490775.1 226 PREDICTED: lipid phosphate phosphatase gamma, chloroplastic-like [Camelina sativa]