Gene/Proteome Database (LMPD)

LMPD ID
LMP010519
Gene ID
831505
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Isopentenyl-diphosphate Delta-isomerase I
Gene Symbol
IPP1
Synonyms
ISOPENTENYL DIPHOSPHATE ISOMERASE; isopentenyl diphosphate isomerase 1; MQK4.17; MQK4_17
Alternate Names
Isopentenyl-diphosphate Delta-isomerase I
Chromosome
5
EC Number
5.3.3.2

Proteins

Isopentenyl-diphosphate Delta-isomerase I
Refseq ID NP_197148
Protein GI 79514626
UniProt ID Q38929
mRNA ID NM_121649
Length 291
RefSeq Status REVIEWED
MSTASLFSFPSFHLRSLLPSLSSSSSSSSSRFAPPRLSPIRSPAPRTQLSVRAFSAVTMTDSNDAGMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFSVFLFNSKYELLLQQRSKTKVTFPLVWTNTCCSHPLYRESELIEENVLGVRNAAQRKLFDELGIVAEDVPVDEFTPLGRMLYKAPSDGKWGEHEVDYLLFIVRDVKLQPNPDEVAEIKYVSREELKELVKKADAGDEAVKLSPWFRLVVDNFLMKWWDHVEKGTITEAADMKTIHKL

Gene Information

Entrez Gene ID
831505
Gene Name
Isopentenyl-diphosphate Delta-isomerase I
Gene Symbol
IPP1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0005829 IDA:TAIR C cytosol
GO:0009536 IDA:TAIR C plastid
GO:0016787 IEA:InterPro F hydrolase activity
GO:0004452 IMP:TAIR F isopentenyl-diphosphate delta-isomerase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0015995 IEA:UniProtKB-UniPathway P chlorophyll biosynthetic process
GO:0050992 IEA:UniProtKB-UniPathway P dimethylallyl diphosphate biosynthetic process
GO:0009240 IMP:TAIR P isopentenyl diphosphate biosynthetic process
GO:0015979 IEA:UniProtKB-KW P photosynthesis

KEGG Pathway Links

KEGG Pathway ID Description
ath_M00095 C5 isoprenoid biosynthesis, mevalonate pathway
ath_M00096 C5 isoprenoid biosynthesis, non-mevalonate pathway
ath00900 Terpenoid backbone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254036 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR011876 Isopentenyl-diphosphate delta-isomerase, type 1
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like

UniProt Annotations

Entry Information

Gene Name
Isopentenyl-diphosphate Delta-isomerase I
Protein Entry
IDI1_ARATH
UniProt ID
Q38929
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Isopentenyl diphosphate = dimethylallyl diphosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 1 Mg(2+) ion per subunit. {ECO:0000250};
Function Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). {ECO:0000250}.
Pathway Isoprenoid biosynthesis; dimethylallyl diphosphate biosynthesis; dimethylallyl diphosphate from isopentenyl diphosphate: step 1/1.
Pathway Porphyrin-containing compound metabolism; chlorophyll biosynthesis.
Sequence Caution Sequence=AAB67741.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AAC49932.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AAL57687.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the IPP isomerase type 1 family. {ECO:0000305}.
Similarity Contains 1 nudix hydrolase domain. {ECO:0000255|PROSITE-ProRule:PRU00794}.
Subcellular Location Plastid, chloroplast {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010519 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
79514626 RefSeq NP_197148 291 Isopentenyl-diphosphate Delta-isomerase I

Identical Sequences to LMP010519 proteins

Reference Database Accession Length Protein Name
GI:79514626 DBBJ BAB09611.1 291 isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase [Arabidopsis thaliana]
GI:79514626 gnl TAIR 291 Isopentenyl-diphosphate Delta-isomerase I [Arabidopsis thaliana]
GI:79514626 SwissProt Q38929.3 291 RecName: Full=Isopentenyl-diphosphate Delta-isomerase I, chloroplastic; AltName: Full=Isopentenyl pyrophosphate isomerase I; Short=IPP isomerase I; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010519 proteins

Reference Database Accession Length Protein Name
GI:79514626 GenBank EFH47977.1 289 isopentenyl pyrophosphate isomerase [Arabidopsis lyrata subsp. lyrata]
GI:79514626 GenBank EOA21272.1 289 hypothetical protein CARUB_v10001624mg [Capsella rubella]
GI:79514626 RefSeq XP_002871718.1 289 isopentenyl pyrophosphate isomerase [Arabidopsis lyrata subsp. lyrata]
GI:79514626 RefSeq XP_006288374.1 289 hypothetical protein CARUB_v10001624mg [Capsella rubella]
GI:79514626 RefSeq XP_010420338.1 289 PREDICTED: isopentenyl-diphosphate Delta-isomerase I, chloroplastic-like isoform X2 [Camelina sativa]
GI:79514626 RefSeq XP_010492543.1 287 PREDICTED: isopentenyl-diphosphate Delta-isomerase I, chloroplastic [Camelina sativa]