Gene/Proteome Database (LMPD)
Proteins
| hydrolase-like protein | |
|---|---|
| Refseq ID | NP_197269 |
| Protein GI | 22326868 |
| UniProt ID | Q9FN84 |
| mRNA ID | NM_121773 |
| Length | 309 |
| RefSeq Status | REVIEWED |
| MASAMVTSLRLRPNFSAATSPSSSSSAGNVKYRPAVILPGLGNNTGDYKKLEVTLGEYGVPAVVAAVSRLDWFRNAAGLVDPAYWRGTLRPRPVLDWYLNRIDDAVREANELAQGQGLCLIGHSAGGWLARVYMEEYGNSDISLLLTLGTPHLPPPRGLPGVIDQTRGLLYYVEENCAKAVYTPELKYVCIAGRYIRGARLVDNADADIDSDVTVGIDSGEGISELAIASNKKSGTFRARFVGQGYKQVCGRADVWGDGVVPEVSAHLEGALNVSFDGVYHSPVGSDDETRPWYGSPVIVKDWIHHLLE | |
Gene Information
Entrez Gene ID
Gene Name
hydrolase-like protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0006505 | IEA:InterPro | P | GPI anchor metabolic process |
| GO:0006886 | IEA:InterPro | P | intracellular protein transport |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP010490 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 22326868 | RefSeq | NP_197269 | 309 | hydrolase-like protein |
Identical Sequences to LMP010490 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22326868 | DBBJ | BAB09566.1 | 309 | unnamed protein product [Arabidopsis thaliana] |
| GI:22326868 | GenBank | AAL32839.1 | 309 | Unknown protein [Arabidopsis thaliana] |
| GI:22326868 | GenBank | AAM91212.1 | 309 | unknown protein [Arabidopsis thaliana] |
| GI:22326868 | gnl | TAIR | 309 | hydrolase-like protein [Arabidopsis thaliana] |
Related Sequences to LMP010490 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22326868 | GenBank | EFH48036.1 | 313 | hypothetical protein ARALYDRAFT_909765 [Arabidopsis lyrata subsp. lyrata] |
| GI:22326868 | GenBank | EOA19518.1 | 316 | hypothetical protein CARUB_v10002429mg [Capsella rubella] |
| GI:22326868 | RefSeq | XP_002871777.1 | 313 | hypothetical protein ARALYDRAFT_909765 [Arabidopsis lyrata subsp. lyrata] |
| GI:22326868 | RefSeq | XP_006286620.1 | 316 | hypothetical protein CARUB_v10002429mg [Capsella rubella] |
| GI:22326868 | RefSeq | XP_010420498.1 | 316 | PREDICTED: uncharacterized protein LOC104706066 [Camelina sativa] |
| GI:22326868 | RefSeq | XP_010453968.1 | 318 | PREDICTED: uncharacterized protein LOC104735811 [Camelina sativa] |