Gene/Proteome Database (LMPD)

LMPD ID
LMP010431
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glycine-rich protein 20
Gene Symbol
Synonyms
ATGRP20; glycine-rich protein 20; GRP20; T2I1.270; T2I1_270
Chromosome
5

Proteins

glycine-rich protein 20
Refseq ID NP_196373
Protein GI 15240816
UniProt ID Q9LY07
mRNA ID NM_120838
Length 153
RefSeq Status REVIEWED
MAPFPLSLIFGKKKRRRDDEIRRQKPTLKGVMTAFFATEAAICLLLLAGISLTGTAVALFASMPLFLVFSPVLVPAGIATTILASGLMAGGTSGVSGLTILMWLYKKYTGRDFPIKIPGAAAAGGAAPAAPAAPAPAAPAAKPAAKPAAKPGA

Gene Information

Entrez Gene ID
Gene Name
glycine-rich protein 20
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:InterPro C integral component of membrane
GO:0012511 IEA:InterPro C monolayer-surrounded lipid storage body
GO:0008289 ISS:TAIR F lipid binding

Domain Information

InterPro Annotations

Accession Description
IPR000136 Oleosin

UniProt Annotations

Entry Information

Gene Name
glycine-rich protein 20
Protein Entry
Q9LY07_ARATH
UniProt ID
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP010431 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240816 RefSeq NP_196373 153 glycine-rich protein 20

Identical Sequences to LMP010431 proteins

Reference Database Accession Length Protein Name
GI:15240816 EMBL CAB87945.1 153 oleosin-like protein [Arabidopsis thaliana]
GI:15240816 GenBank AAK83839.1 153 glycine-rich protein GRP20 [Arabidopsis thaliana]
GI:15240816 GenBank AAO42133.1 153 putative glycine-rich protein GRP20 [Arabidopsis thaliana]
GI:15240816 GenBank AAO63886.1 153 putative glycine-rich protein GRP20 [Arabidopsis thaliana]
GI:15240816 GenBank AGD03323.1 153 Sequence 779 from patent US 8343764
GI:15240816 gnl TAIR 153 glycine-rich protein 20 [Arabidopsis thaliana]

Related Sequences to LMP010431 proteins

Reference Database Accession Length Protein Name
GI:15240816 GenBank AAK83826.1 153 glycine-rich protein GRP20 [Arabidopsis thaliana]
GI:15240816 GenBank AAK83832.1 147 glycine-rich protein GRP20 [Arabidopsis thaliana]
GI:15240816 GenBank AAK83838.1 149 glycine-rich protein GRP20 [Arabidopsis thaliana]
GI:15240816 GenBank AGD14190.1 153 Sequence 11646 from patent US 8343764
GI:15240816 GenBank AGD14191.1 147 Sequence 11647 from patent US 8343764
GI:15240816 GenBank AGD14192.1 149 Sequence 11648 from patent US 8343764