Gene/Proteome Database (LMPD)

LMPD ID
LMP010359
Gene ID
818540
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
geranylgeranyl transferase type-1 subunit beta
Gene Symbol
PGGT-I
Synonyms
ATGGT-IB; GERANYLGERANYLTRANSFERASE-I BETA SUBUNIT; GGB; PGGT-I
Alternate Names
geranylgeranyl transferase type-1 subunit beta
Chromosome
2
EC Number
2.5.1.59
Summary
encodes the beta subunit of geranylgeranyl transferase (GGT-IB), involved in both ABA-mediated and auxin signaling pathways.
Orthologs
View orthologs and multiple alignments for PGGT-I

Proteins

geranylgeranyl transferase type-1 subunit beta
Refseq ID NP_181487
Protein GI 15225494
UniProt ID O80642
mRNA ID NM_129513
Length 375
RefSeq Status REVIEWED
MSETAVSIDSDRSKSEEEDEEEYSPPVQSSPSANFEKDRHLMYLEMMYELLPYHYQSQEINRLTLAHFIISGLHFLGARDRVDKDVVAKWVLSFQAFPTNRVSLKDGEFYGFFGSRSSQFPIDENGDLKHNGSHLASTYCALAILKVIGHDLSTIDSKSLLISMINLQQDDGSFMPIHIGGETDLRFVYCAAAICYMLDSWSGMDKESAKNYILNCQSYDGGFGLIPGSESHGGATYCAIASLRLMGYIGVDLLSNDSSSSIIDPSLLLNWCLQRQANDGGFQGRTNKPSDTCYAFWIGAVLKLIGGDALIDKMALRKFLMSCQSKYGGFSKFPGQLPDLYHSYYGYTAFSLLEEQGLSPLCPELGLPLLAAPGI

Gene Information

Entrez Gene ID
818540
Gene Name
geranylgeranyl transferase type-1 subunit beta
Gene Symbol
PGGT-I
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004662 IMP:TAIR F CAAX-protein geranylgeranyltransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0046982 IPI:TAIR F protein heterodimerization activity
GO:0009788 TAS:TAIR P negative regulation of abscisic acid-activated signaling pathway
GO:0018344 IMP:TAIR P protein geranylgeranylation
GO:0009737 IMP:TAIR P response to abscisic acid
GO:0009733 IMP:TAIR P response to auxin
GO:0009414 IMP:TAIR P response to water deprivation

Domain Information

InterPro Annotations

Accession Description
IPR001330 Prenyltransferase/squalene oxidase
IPR008930 Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid

UniProt Annotations

Entry Information

Gene Name
geranylgeranyl transferase type-1 subunit beta
Protein Entry
PGTB1_ARATH
UniProt ID
O80642
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=5.8 uM for CVIM substrate {ECO:0000269|PubMed:11500541, ECO:0000269|PubMed:20565889}; KM=3.5 uM for CVIQ substrate {ECO:0000269|PubMed:11500541, ECO:0000269|PubMed:20565889}; KM=19.0 uM for CVII substrate {ECO:0000269|PubMed:11500541, ECO:0000269|PubMed:20565889}; KM=17.2 uM for CVIL substrate {ECO:0000269|PubMed:11500541, ECO:0000269|PubMed:20565889}; Note=Kcat is 0.5 h(-1), 0.08 h(-1), 0.008 h(-1) and 0.012 h(-1) for CVIL, CVII, CVIQ and CVIM substrates, respectively.; pH dependence: Optimum pH is 7.9-8.5 for CTIL substrate. {ECO:0000269|PubMed:11500541, ECO:0000269|PubMed:20565889}; Temperature dependence: Optimum temperature is 30-37 degrees Celsius for CTIL substrate. {ECO:0000269|PubMed:11500541, ECO:0000269|PubMed:20565889};
Catalytic Activity Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate.
Cofactor Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250};
Disruption Phenotype No visible phenotype under normal growth conditions, but mutant plants have an enhanced response to abscisic acid (ABA)-mediated stomatal closure and increased lateral root formation in response to exogenous auxin. {ECO:0000269|PubMed:16183844}.
Function Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X (CaaX). Seems to exclusively prenylate CaaX substrates with leucine in the terminal position. The beta subunit is responsible for peptide-binding. May negatively regulate abscisic acid (ABA) signaling in guard cells and auxin- induced lateral root initiation.
Function Negatively regulates ABA signaling in guard cells. in negative regulation of auxin-induced lateral root initiation.
Sequence Caution Sequence=AAG40865.1; Type=Frameshift; Positions=106; Evidence={ECO:0000305};
Similarity Belongs to the protein prenyltransferase subunit beta family. {ECO:0000305}.
Similarity Contains 4 PFTB repeats. {ECO:0000305}.
Subunit Heterodimer of an alpha and a beta subunit. {ECO:0000250}.
Tissue Specificity Expressed in roots, leaves, stems, flowers and siliques. {ECO:0000269|PubMed:11500541}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010359 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15225494 RefSeq NP_181487 375 geranylgeranyl transferase type-1 subunit beta

Identical Sequences to LMP010359 proteins

Reference Database Accession Length Protein Name
GI:15225494 GenBank AAO00825.1 375 putative geranylgeranyl transferase type I beta subunit [Arabidopsis thaliana]
GI:15225494 GenBank AAP37823.1 375 At2g39550 [Arabidopsis thaliana]
GI:15225494 GenBank AEC09693.1 375 geranylgeranyl transferase type-1 subunit beta [Arabidopsis thaliana]
GI:15225494 gnl TIGR 375 putative geranylgeranyl transferase type I beta subunit [Arabidopsis thaliana]
GI:15225494 SwissProt O80642.1 375 RecName: Full=Geranylgeranyl transferase type-1 subunit beta; AltName: Full=Geranylgeranyl transferase type I subunit beta; Short=AtGGT-IB; Short=GGTase-I-beta [Arabidopsis thaliana]

Related Sequences to LMP010359 proteins

Reference Database Accession Length Protein Name
GI:15225494 GenBank AAG40865.1 376 geranylgeranyltransferase beta subunit [Arabidopsis thaliana]
GI:15225494 GenBank EOA28924.1 386 hypothetical protein CARUB_v10025181mg [Capsella rubella]
GI:15225494 RefSeq XP_006296026.1 386 hypothetical protein CARUB_v10025181mg [Capsella rubella]
GI:15225494 RefSeq XP_010505638.1 386 PREDICTED: geranylgeranyl transferase type-1 subunit beta [Camelina sativa]
GI:15225494 RefSeq XP_010509002.1 387 PREDICTED: geranylgeranyl transferase type-1 subunit beta-like [Camelina sativa]
GI:15225494 RefSeq XP_010517309.1 387 PREDICTED: geranylgeranyl transferase type-1 subunit beta-like [Camelina sativa]