Gene/Proteome Database (LMPD)

LMPD ID
LMP010357
Gene ID
820678
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
geranylgeranyl pyrophosphate synthase 9
Gene Symbol
AT3G14530
Alternate Names
geranylgeranyl pyrophosphate synthase 9
Chromosome
3
EC Number
2.5.1.-

Proteins

geranylgeranyl pyrophosphate synthase 9
Refseq ID NP_188071
Protein GI 15231877
UniProt ID Q9LUE1
mRNA ID NM_112313
Length 360
RefSeq Status REVIEWED
MATTVHLSSSSLFSQSRGRRDNSISSVKSLRKRTVLSLSSALTSQDAGHMIQPEGKSNDNNSAFDFKLYMIRKAESVNAALDVSVPLLKPLTIQEAVRYSLLAGGKRVRPLLCIAACELVGGDEATAMSAACAVEMIHTSSLIHDDLPCMDNADLRRGKPTNHKVYGEDMAVLAGDALLALAFEHMTVVSSGLVAPEKMIRAVVELARAIGTTGLVAGQMIDLASERLNPDKVGLEHLEFIHLHKTAALLEAAAVLGVIMGGGTEQEIEKLRKYARCIGLLFQVVDDILDVTKSTEELGKTAGKDVMAGKLTYPRLIGLEGSREVAEKLRREAEEQLLGFDPSKAAPLVALASYIACRHN

Gene Information

Entrez Gene ID
820678
Gene Name
geranylgeranyl pyrophosphate synthase 9
Gene Symbol
AT3G14530
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IEA:UniProtKB-KW C chloroplast
GO:0004161 IEA:UniProtKB-EC F dimethylallyltranstransferase activity
GO:0004311 IEA:UniProtKB-EC F farnesyltranstransferase activity
GO:0004337 IEA:UniProtKB-EC F geranyltranstransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0016117 IEA:UniProtKB-KW P carotenoid biosynthetic process
GO:0045337 IEA:UniProtKB-UniPathway P farnesyl diphosphate biosynthetic process
GO:0033384 IEA:UniProtKB-UniPathway P geranyl diphosphate biosynthetic process
GO:0033386 IEA:UniProtKB-UniPathway P geranylgeranyl diphosphate biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath01100 Metabolic pathways
ath00900 Terpenoid backbone biosynthesis
ko00900 Terpenoid backbone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR008949 Isoprenoid synthase domain
IPR000092 Polyprenyl synthetase
IPR017446 Polyprenyl synthetase-related

UniProt Annotations

Entry Information

Gene Name
geranylgeranyl pyrophosphate synthase 9
Protein Entry
GGPP9_ARATH
UniProt ID
Q9LUE1
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity (2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = diphosphate + geranylgeranyl diphosphate.
Catalytic Activity Dimethylallyl diphosphate + isopentenyl diphosphate = diphosphate + geranyl diphosphate.
Catalytic Activity Geranyl diphosphate + isopentenyl diphosphate = diphosphate + (2E,6E)-farnesyl diphosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 3 Mg(2+) ions per subunit. {ECO:0000250};
Function Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate. {ECO:0000250}.
Pathway Isoprenoid biosynthesis; farnesyl diphosphate biosynthesis; farnesyl diphosphate from geranyl diphosphate and isopentenyl diphosphate: step 1/1.
Pathway Isoprenoid biosynthesis; geranyl diphosphate biosynthesis; geranyl diphosphate from dimethylallyl diphosphate and isopentenyl diphosphate: step 1/1.
Pathway Isoprenoid biosynthesis; geranylgeranyl diphosphate biosynthesis; geranylgeranyl diphosphate from farnesyl diphosphate and isopentenyl diphosphate: step 1/1.
Similarity Belongs to the FPP/GGPP synthase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast {ECO:0000305}.
Subunit Monomer (By similarity). No interactions with GGR. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010357 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15231877 RefSeq NP_188071 360 geranylgeranyl pyrophosphate synthase 9

Identical Sequences to LMP010357 proteins

Reference Database Accession Length Protein Name
GI:15231877 EMBL CBF64799.1 360 unnamed protein product [Arabidopsis thaliana]
GI:15231877 EMBL CBU89670.1 360 unnamed protein product [Arabidopsis thaliana]
GI:15231877 GenBank AAQ65086.1 360 At3g14530 [Arabidopsis thaliana]
GI:15231877 GenBank AEE75535.1 360 geranylgeranyl pyrophosphate synthase 9 [Arabidopsis thaliana]
GI:15231877 GenBank AGX56672.1 360 Sequence 13682 from patent US 8541208
GI:15231877 SwissProt Q9LUE1.1 360 RecName: Full=Geranylgeranyl pyrophosphate synthase 9, chloroplastic; Short=GGPP synthase 9; Short=GGPS9; AltName: Full=(2E,6E)-farnesyl diphosphate synthase 9; AltName: Full=Dimethylallyltranstransferase 9; AltName: Full=Farnesyl diphosphate synthase 9; AltName: Full=Farnesyltranstransferase 9; AltName: Full=Geranyltranstransferase 9; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010357 proteins

Reference Database Accession Length Protein Name
GI:15231877 DBBJ BAB02387.1 360 geranylgeranyl pyrophosphate synthase [Arabidopsis thaliana]
GI:15231877 GenBank AEE75537.1 360 geranylgeranyl pyrophosphate synthase 3 [Arabidopsis thaliana]
GI:15231877 GenBank AFX48648.1 360 Sequence 50481 from patent US 8299318
GI:15231877 GenBank AGF14948.1 360 Sequence 14367 from patent US 8362325
GI:15231877 RefSeq NP_188073.2 360 geranylgeranyl pyrophosphate synthase 3 [Arabidopsis thaliana]
GI:15231877 SwissProt Q9LUD9.1 360 RecName: Full=Geranylgeranyl pyrophosphate synthase 3, chloroplastic; Short=GGPP synthase 3; Short=GGPS3; AltName: Full=(2E,6E)-farnesyl diphosphate synthase 3; AltName: Full=Dimethylallyltranstransferase 3; AltName: Full=Farnesyl diphosphate synthase 3; AltName: Full=Farnesyltranstransferase 3; AltName: Full=Geranyltranstransferase 3; Flags: Precursor [Arabidopsis thaliana]