Gene/Proteome Database (LMPD)
Proteins
| GDSL-like lipase/acylhydrolase-like protein | |
|---|---|
| Refseq ID | NP_001117318 |
| Protein GI | 240254123 |
| UniProt ID | B3H5G5 |
| mRNA ID | NM_001123846 |
| Length | 328 |
| RefSeq Status | REVIEWED |
| MENANIKVLVVLLSIWISCVQAQTGTFSAVLAFGDSILDTGNNNLLMTVSRGNFLPYGRDFPHRIPTGRFGNGRVLSDLVASGLGVKDLLPAFRSPFLKNSELATGVCFASGGSGLDKFTASIQGVIWVQDQVSDFQRYLEKLNQQVGDAAKVKEIIANAVILVSAGNNDLAITYFSTPKRQTRYTVQAYTDMLIGWKTTFINSLYDLGARKFAILGTLPLGCLPGARQITGNLICLPNVNYGARVYNDKVANLVNQYNQRLPNGKFVYIDMYNSLLEVINNPSQYGFTTAKPCCCSVMTPIPCLRSGSHVFWDFAHPSEKAYKTVLP | |
Gene Information
Entrez Gene ID
Gene Name
GDSL-like lipase/acylhydrolase-like protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016298 | IEA:InterPro | F | lipase activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
GDSL-like lipase/acylhydrolase-like protein
Protein Entry
B3H5G5_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP010347 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 240254123 | RefSeq | NP_001117318 | 328 | GDSL-like lipase/acylhydrolase-like protein |
Identical Sequences to LMP010347 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:240254123 | GenBank | AEE29942.1 | 328 | GDSL-like lipase/acylhydrolase-like protein [Arabidopsis thaliana] |
Related Sequences to LMP010347 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:240254123 | EMBL | CDY57589.1 | 467 | BnaAnng14660D [Brassica napus] |
| GI:240254123 | EMBL | CDY43409.1 | 340 | BnaC07g14760D [Brassica napus] |
| GI:240254123 | GenBank | AAF79900.1 | 1137 | Contains a strong similarity to Anther-specific proline-rich protein APG precursor from Arabidopsis thaliana gi|728867 and contains a Lipase/Acylhydrolase domain with GDSL-like motif PF|00657. ESTs gb|AV531882, gb|AV533240, gb|AV534374, gb|AV533394, gb|AV532582, gb|AV533541 come from this gene [Arabidopsis thaliana] |
| GI:240254123 | GenBank | EOA39328.1 | 336 | hypothetical protein CARUB_v10012369mg [Capsella rubella] |
| GI:240254123 | RefSeq | XP_006306430.1 | 336 | hypothetical protein CARUB_v10012369mg [Capsella rubella] |
| GI:240254123 | RefSeq | XP_010480553.1 | 337 | PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g63170 [Camelina sativa] |