Gene/Proteome Database (LMPD)

LMPD ID
LMP010337
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
epithiospecifier modifier 1
Gene Symbol
Synonyms
epithiospecifier modifier 1; ESM1
Alternate Names
epithiospecifier modifier 1
Chromosome
3
EC Number
3.1.1.-
Summary
A semidominant QTL which has an epistatic effect on the Epithiospecifier gene. Represses nitrile formation and favors isothiocyanate production during glucosinolate hydrolysis. The functional allele deters the insect herbivory T. ni.
Orthologs

Proteins

epithiospecifier modifier 1
Refseq ID NP_188037
Protein GI 15231805
UniProt ID Q9LJG3
mRNA ID NM_112278
Length 392
RefSeq Status REVIEWED
MADNLNLVSVLGVLLVLTIFHNPIIVYAGEGVPNVALFTFGDSYYDAGNKVFLSQRKDLPQTYWPYGKSRDYPNGKFSDGHIVPDFIADFISIPNGVLPPVLKPGVDISRGVSFAVADASILGAPVESMTLNQQVVKFKNMKSNWNDSYIEKSLFMIYIGTEDYLNFTKANPNADASAQQAFVTNVINRLKNDIKLLYSLGASKFVVQLLAPLGCLPIVRQEYKTGNECYELLNDLAKQHNGKIGPMLNEFAKISTSPYGFQFTVFDFYNAVLRRIATGRSLNYRFFVTNTSCCGVGTHNAYGCGKGNVHSKLCEYQRSYFFFDGRHNTEKAQEEMAHLLYGADPDVVQPMTVRELIVYPTGETMREYWEPNNLAIRRRPSRDFYLGLAAYY

Gene Information

Entrez Gene ID
Gene Name
epithiospecifier modifier 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IDA:TAIR C apoplast
GO:0009507 IDA:TAIR C chloroplast
GO:0009941 IDA:TAIR C chloroplast envelope
GO:0022626 IDA:TAIR C cytosolic ribosome
GO:0016020 IDA:TAIR C membrane
GO:0005634 IDA:TAIR C nucleus
GO:0005777 IDA:TAIR C peroxisome
GO:0009506 IDA:TAIR C plasmodesma
GO:0005773 IDA:TAIR C vacuole
GO:0016788 IEA:InterPro F hydrolase activity, acting on ester bonds
GO:0042742 IEP:TAIR P defense response to bacterium
GO:0019762 IDA:TAIR P glucosinolate catabolic process
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0009409 IEP:TAIR P response to cold
GO:0009625 IMP:TAIR P response to insect

Domain Information

InterPro Annotations

Accession Description
IPR001087 Lipase, GDSL

UniProt Annotations

Entry Information

Gene Name
epithiospecifier modifier 1
Protein Entry
ESM1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype In cv. Columbia, altered ratio of endogenous nitrile to isothiocyanate hydrolysis products. {ECO:0000269|PubMed:16679459}.
Function Represses or inhibits nitriles production from methionine-derived and from indol-3-ylmethyl glucosinolates. Favors isothiocyanate production. {ECO:0000269|PubMed:16679459, ECO:0000269|PubMed:17920088}.
Miscellaneous ESM1 is highly expressed in cv. Columbia while lowly expressed cv. Landsberg erecta.
Similarity Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000305}. Peroxisome {ECO:0000269|PubMed:17951448}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010337 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15231805 RefSeq NP_188037 392 epithiospecifier modifier 1

Identical Sequences to LMP010337 proteins

Reference Database Accession Length Protein Name
GI:15231805 EMBL CBC25796.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CBC39320.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CBC10276.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CBC89613.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CBC58482.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 GenBank AEE75487.1 392 epithiospecifier modifier 1 [Arabidopsis thaliana]

Related Sequences to LMP010337 proteins

Reference Database Accession Length Protein Name
GI:15231805 EMBL CAW53815.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CAW70212.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CAW60600.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CAW45001.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 EMBL CAW87385.1 392 unnamed protein product [Arabidopsis thaliana]
GI:15231805 GenBank AAK96511.1 392 AT3g14210/MAG2_18 [Arabidopsis thaliana]