Gene/Proteome Database (LMPD)
LMPD ID
LMP010337
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
epithiospecifier modifier 1
Gene Symbol
Synonyms
epithiospecifier modifier 1; ESM1
Alternate Names
epithiospecifier modifier 1
Chromosome
3
EC Number
3.1.1.-
Summary
A semidominant QTL which has an epistatic effect on the Epithiospecifier gene. Represses nitrile formation and favors isothiocyanate production during glucosinolate hydrolysis. The functional allele deters the insect herbivory T. ni.
Orthologs
Proteins
| epithiospecifier modifier 1 | |
|---|---|
| Refseq ID | NP_188037 |
| Protein GI | 15231805 |
| UniProt ID | Q9LJG3 |
| mRNA ID | NM_112278 |
| Length | 392 |
| RefSeq Status | REVIEWED |
| MADNLNLVSVLGVLLVLTIFHNPIIVYAGEGVPNVALFTFGDSYYDAGNKVFLSQRKDLPQTYWPYGKSRDYPNGKFSDGHIVPDFIADFISIPNGVLPPVLKPGVDISRGVSFAVADASILGAPVESMTLNQQVVKFKNMKSNWNDSYIEKSLFMIYIGTEDYLNFTKANPNADASAQQAFVTNVINRLKNDIKLLYSLGASKFVVQLLAPLGCLPIVRQEYKTGNECYELLNDLAKQHNGKIGPMLNEFAKISTSPYGFQFTVFDFYNAVLRRIATGRSLNYRFFVTNTSCCGVGTHNAYGCGKGNVHSKLCEYQRSYFFFDGRHNTEKAQEEMAHLLYGADPDVVQPMTVRELIVYPTGETMREYWEPNNLAIRRRPSRDFYLGLAAYY | |
Gene Information
Entrez Gene ID
Gene Name
epithiospecifier modifier 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0048046 | IDA:TAIR | C | apoplast |
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0022626 | IDA:TAIR | C | cytosolic ribosome |
| GO:0016020 | IDA:TAIR | C | membrane |
| GO:0005634 | IDA:TAIR | C | nucleus |
| GO:0005777 | IDA:TAIR | C | peroxisome |
| GO:0009506 | IDA:TAIR | C | plasmodesma |
| GO:0005773 | IDA:TAIR | C | vacuole |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0042742 | IEP:TAIR | P | defense response to bacterium |
| GO:0019762 | IDA:TAIR | P | glucosinolate catabolic process |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0009409 | IEP:TAIR | P | response to cold |
| GO:0009625 | IMP:TAIR | P | response to insect |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Gene Name
epithiospecifier modifier 1
Protein Entry
ESM1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | In cv. Columbia, altered ratio of endogenous nitrile to isothiocyanate hydrolysis products. {ECO:0000269|PubMed:16679459}. |
| Function | Represses or inhibits nitriles production from methionine-derived and from indol-3-ylmethyl glucosinolates. Favors isothiocyanate production. {ECO:0000269|PubMed:16679459, ECO:0000269|PubMed:17920088}. |
| Miscellaneous | ESM1 is highly expressed in cv. Columbia while lowly expressed cv. Landsberg erecta. |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. Peroxisome {ECO:0000269|PubMed:17951448}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010337 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15231805 | RefSeq | NP_188037 | 392 | epithiospecifier modifier 1 |
Identical Sequences to LMP010337 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15231805 | EMBL | CBC25796.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CBC39320.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CBC10276.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CBC89613.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CBC58482.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | GenBank | AEE75487.1 | 392 | epithiospecifier modifier 1 [Arabidopsis thaliana] |
Related Sequences to LMP010337 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15231805 | EMBL | CAW53815.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CAW70212.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CAW60600.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CAW45001.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | EMBL | CAW87385.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15231805 | GenBank | AAK96511.1 | 392 | AT3g14210/MAG2_18 [Arabidopsis thaliana] |