Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_566387 |
| Protein GI | 18399151 |
| UniProt ID | Q9SRM5 |
| mRNA ID | NM_111956 |
| Length | 256 |
| RefSeq Status | REVIEWED |
| MVGPARPQIVLFGSSIVQMSFGHGGWGAILSEVYARKADIILRGYYGWNSSRALEVVDQVFPKDAAVQPSLVIVYFGGNDSMAPHSSGLGPHVPLTEYVDNMKKIALHLQSLSDFTRIIFLSSPPVDEAKVRQNQSPYLSEVIRTNDLCKTYSDACVELCQELGLEVVDLFSTFQKADDWKTVCFTDGIHLSAQGSKIVAGEILRVVKEAEWHPSLHWKSMPTEFADDSPYDLVSADGKQTVNSSEWTYFWEEQWD | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0048046 | IDA:TAIR | C | apoplast |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
| Tissue Specificity | Specifically expressed in anthers (stages 8- 12). {ECO:0000269|PubMed:16055634}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010336 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18399151 | RefSeq | NP_566387 | 256 | GDSL esterase/lipase |
Identical Sequences to LMP010336 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18399151 | DBBJ | BAF00764.1 | 256 | hypothetical protein [Arabidopsis thaliana] |
| GI:18399151 | GenBank | AAF01505.1 | 256 | unknown protein [Arabidopsis thaliana] |
| GI:18399151 | GenBank | AAG50959.1 | 256 | unknown protein; 50065-48267 [Arabidopsis thaliana] |
| GI:18399151 | GenBank | ABD59113.1 | 256 | At3g11210 [Arabidopsis thaliana] |
| GI:18399151 | GenBank | AEE75014.1 | 256 | GDSL esterase/lipase [Arabidopsis thaliana] |
| GI:18399151 | SwissProt | Q9SRM5.1 | 256 | RecName: Full=GDSL esterase/lipase CPRD49; AltName: Full=Extracellular lipase CPRD49; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010336 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18399151 | GenBank | AAM63310.1 | 256 | CPRD49 [Arabidopsis thaliana] |
| GI:18399151 | GenBank | EFH61095.1 | 256 | CPRD49 [Arabidopsis lyrata subsp. lyrata] |
| GI:18399151 | RefSeq | XP_002884836.1 | 256 | CPRD49 [Arabidopsis lyrata subsp. lyrata] |
| GI:18399151 | RefSeq | XP_006407465.1 | 256 | hypothetical protein EUTSA_v10021365mg [Eutrema salsugineum] |
| GI:18399151 | RefSeq | XP_010487340.1 | 256 | PREDICTED: GDSL esterase/lipase CPRD49-like [Camelina sativa] |
| GI:18399151 | RefSeq | XP_010486764.1 | 256 | PREDICTED: GDSL esterase/lipase CPRD49 [Camelina sativa] |