Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_193357 |
| Protein GI | 334186600 |
| UniProt ID | O23469 |
| mRNA ID | NM_117718 |
| Length | 214 |
| RefSeq Status | REVIEWED |
| MSSLVSRCQVIALLVLFFFGVCLAGKDIPANFVFGDSLVEVGNNNYLATLAKANNFPNGIDFGSPTGRFTNGRTIVDIICKYSSYTKVNNSTTNTNGVKMLKAMMFGVNYLAPVFFKKMDGQTIAISSLSTLSRAANLYRQILAKEVAKAIAQDTTTDLPKASHGVSSSSVKEELRPKETYFCDFYGRPIVYPILTSARRVTWARKINYDINNM | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=AEE83718.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB10401.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB78664.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010309 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 334186600 | RefSeq | NP_193357 | 214 | GDSL esterase/lipase |
Identical Sequences to LMP010309 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:334186600 | GenBank | AEE83718.1 | 214 | GDSL esterase/lipase [Arabidopsis thaliana] |
Related Sequences to LMP010309 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:334186600 | EMBL | CAB10401.1 | 201 | hypothetical protein [Arabidopsis thaliana] |
| GI:334186600 | EMBL | CAB78664.1 | 201 | hypothetical protein [Arabidopsis thaliana] |
| GI:334186600 | EMBL | CAB78665.1 | 340 | proline-rich, APG like protein [Arabidopsis thaliana] |
| GI:334186600 | EMBL | CAW53601.1 | 340 | unnamed protein product [Arabidopsis thaliana] |
| GI:334186600 | EMBL | CAW69998.1 | 340 | unnamed protein product [Arabidopsis thaliana] |
| GI:334186600 | SwissProt | O23469.2 | 245 | RecName: Full=GDSL esterase/lipase At4g16220; AltName: Full=Extracellular lipase At4g16220; Flags: Precursor [Arabidopsis thaliana] |