Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_565883 |
| Protein GI | 18404664 |
| UniProt ID | O80443 |
| mRNA ID | NM_129374 |
| Length | 312 |
| RefSeq Status | REVIEWED |
| MVGPVRPQIVLFGSSIVQYSFTDRGWGATLADLYSRTADIILRGYAGWNSRFALKVLHQVFPKDAVIQPSLVIVYFGGNDSTHPHPSGHGPHVPLSEFIENMRKIGEHLLSLSDKTRVIFLTPPPMNEKQIEIVFGDAIKGRSNELCRPYAEELLNLCREINVKGIDIWTAIQQQDDWLNSCFTDGIHFTAKASEIVVKEILKVLRGADWKPSLYWKSLPVEFPFDFDAPNSISLHDLELTRNNHFESPHLVSLCEQELTRNEQLEPPHPVSLCDHELTRNEQLEPPHPVSLCDHELTQNEQLEPPQPTARL | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Caution | Lacks the conserved active site 'GDSL' motif. Its enzyme activity is therefore unsure. {ECO:0000305}. |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010292 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18404664 | RefSeq | NP_565883 | 312 | GDSL esterase/lipase |
Identical Sequences to LMP010292 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18404664 | GenBank | AAX12857.1 | 312 | At2g38180 [Arabidopsis thaliana] |
| GI:18404664 | GenBank | AAX12886.1 | 312 | At2g38180 [Arabidopsis thaliana] |
| GI:18404664 | GenBank | AEC09502.1 | 312 | GDSL esterase/lipase [Arabidopsis thaliana] |
| GI:18404664 | gnl | TIGR | 312 | expressed protein [Arabidopsis thaliana] |
| GI:18404664 | SwissProt | O80443.1 | 312 | RecName: Full=GDSL esterase/lipase At2g38180; AltName: Full=Extracellular lipase At2g38180; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010292 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18404664 | GenBank | AAL31218.1 | 312 | At2g38180/F16M14.11 [Arabidopsis thaliana] |
| GI:18404664 | GenBank | EFH55989.1 | 294 | GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18404664 | RefSeq | XP_002879730.1 | 294 | GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18404664 | RefSeq | XP_009133234.1 | 250 | PREDICTED: GDSL esterase/lipase At2g38180-like [Brassica rapa] |
| GI:18404664 | RefSeq | XP_010509212.1 | 273 | PREDICTED: GDSL esterase/lipase At2g38180-like isoform X1 [Camelina sativa] |
| GI:18404664 | RefSeq | XP_010517106.1 | 273 | PREDICTED: GDSL esterase/lipase At2g38180 isoform X1 [Camelina sativa] |