Gene/Proteome Database (LMPD)
LMPD ID
LMP010244
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
GDSL motif lipase 3
Gene Symbol
Synonyms
F15I1.7; F15I1_7; GDSL-motif lipase 3; GLIP3
Alternate Names
GDSL motif lipase 3
Chromosome
1
EC Number
3.1.1.-
Summary
Contains lipase signature motif and GDSL domain.
Orthologs
Proteins
| GDSL motif lipase 3 | |
|---|---|
| Refseq ID | NP_175801 |
| Protein GI | 15221018 |
| UniProt ID | Q9SYF5 |
| mRNA ID | NM_104276 |
| Length | 367 |
| RefSeq Status | REVIEWED |
| MVRLVLIIFFVYTIILSIGSINCIDNNNLVTNQAALFVFGDSLFDAGNNNYINTVSSFRSNIWPYGQTNFKFPTGRLSDGPEKAWLPSIPPNLQPNNGNNQFTYGVSFASAGAGALAESFLGMVINLGTQLNNFKDVEKSLRSELGDAETKRVFSRAVYLFHIGANDYFYPFSANSSTFKSNSKEKFVDFVIGNITFVIEEVYKMGGRKFGFLNVGPYECSPNSLIRDRTKIGSCFKPVAELIDMHNKKFPDVLRRLQRQLSGFRYALHDYHTSLSERINSPSKYGFKEGKKACCGSGPLRGINTCGNRIGPSQGYGLCENVTDYLFYDSSHLTEKAHRQIAELIWNGPPNVTRPYNLKALFELRLT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016298 | ISS:TAIR | F | lipase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-3301 | sinapate ester biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=AAD25771.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010244 (as displayed in Record Overview)
Identical Sequences to LMP010244 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221018 | EMBL | CBC09179.1 | 367 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC10246.1 | 367 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC89557.1 | 367 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC58426.1 | 367 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC57282.1 | 367 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | GenBank | AEE33032.1 | 367 | GDSL motif lipase 3 [Arabidopsis thaliana] |
Related Sequences to LMP010244 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221018 | EMBL | CBC26276.1 | 397 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC39803.1 | 397 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC09191.1 | 397 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC10524.1 | 397 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC58975.1 | 397 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221018 | EMBL | CBC57308.1 | 397 | unnamed protein product [Arabidopsis thaliana] |