Gene/Proteome Database (LMPD)

LMPD ID
LMP010213
Gene ID
836565
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acid amide hydrolase
Gene Symbol
FAAH
Synonyms
AtFAAH; FAAH; fatty acid amide hydrolase
Alternate Names
fatty acid amide hydrolase
Chromosome
5
EC Number
3.5.1.99

Proteins

fatty acid amide hydrolase
Refseq ID NP_201249
Protein GI 186532737
UniProt ID Q7XJJ7
mRNA ID NM_125840
Length 607
RefSeq Status REVIEWED
MGKYQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNGMTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHADPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQAEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFSASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIFYDILNTN

Gene Information

Entrez Gene ID
836565
Gene Name
fatty acid amide hydrolase
Gene Symbol
FAAH
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:TAIR C plasma membrane
GO:0005774 IDA:TAIR C vacuolar membrane
GO:0005773 IDA:TAIR C vacuole
GO:0047412 IMP:TAIR F N-(long-chain-acyl)ethanolamine deacylase activity
GO:0016884 IEA:InterPro F carbon-nitrogen ligase activity, with glutamine as amido-N-donor
GO:0070291 IMP:TAIR P N-acylethanolamine metabolic process
GO:0042742 IMP:TAIR P defense response to bacterium

Domain Information

InterPro Annotations

Accession Description
IPR000120 Amidase
IPR023631 Amidase signature domain
IPR020556 Amidase, conserved site

UniProt Annotations

Entry Information

Gene Name
fatty acid amide hydrolase
Protein Entry
FAAH_ARATH
UniProt ID
Q7XJJ7
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=13.6 uM for N-actylethanolamine 20:4 {ECO:0000269|PubMed:12824167}; KM=26.2 uM for N-actylethanolamine 18:2 {ECO:0000269|PubMed:12824167}; KM=50.8 uM for N-actylethanolamine 16:0 {ECO:0000269|PubMed:12824167}; KM=37.0 uM for N-actylethanolamine 14:0 {ECO:0000269|PubMed:12824167}; KM=17.6 uM for N-actylethanolamine 12:0 {ECO:0000269|PubMed:12824167}; Vmax=17.9 umol/h/mg enzyme with N-actylethanolamine 20:4 as substrate {ECO:0000269|PubMed:12824167}; Vmax=14.1 umol/h/mg enzyme with N-actylethanolamine 18:2 as substrate {ECO:0000269|PubMed:12824167}; Vmax=12.1 umol/h/mg enzyme with N-actylethanolamine 16:0 as substrate {ECO:0000269|PubMed:12824167}; Vmax=9.1 umol/h/mg enzyme with N-actylethanolamine 14:0 as substrate {ECO:0000269|PubMed:12824167}; Vmax=13.9 umol/h/mg enzyme with N-actylethanolamine 12:0 as substrate {ECO:0000269|PubMed:12824167};
Catalytic Activity Anandamide + H(2)O = arachidonic acid + ethanolamine.
Catalytic Activity Oleamide + H(2)O = oleic acid + NH(3).
Developmental Stage Up-regulated during seed germination and early postgerminative seedling growth. {ECO:0000269|PubMed:16880402}.
Disruption Phenotype No visible phenotype and enhanced sensitivity to growth inhibition induced by exogenous N- actylethanolamine. {ECO:0000269|PubMed:16880402}.
Enzyme Regulation Inhibited by methylarachidonyl fluorophosphonate (MAFP). {ECO:0000269|PubMed:12824167}.
Function Degrades bioactive fatty acid amides to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Converts N-actylethanolamine (NAE) to ethanolamine. Can also use oleamide or 2-arachidonylglycerol as substrates, but not indole-3-acetamide, 1-naphtalene-acetamide, nicotinic acid amide or L-asparagine. Might be involved in abscisic acid signaling and plant defense through distinctly different mechanisms not involving the catalytic activity. {ECO:0000269|PubMed:12824167, ECO:0000269|PubMed:16880402, ECO:0000269|PubMed:18643971, ECO:0000269|PubMed:19801664}.
Sequence Caution Sequence=AAL09742.1; Type=Frameshift; Positions=148; Evidence={ECO:0000305};
Similarity Belongs to the amidase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. Cell membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed in seedlings, flowers, roots, siliques, seeds and leaves. Lower levels in stems. {ECO:0000269|PubMed:16738862, ECO:0000269|PubMed:16880402}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010213 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
186532737 RefSeq NP_201249 607 fatty acid amide hydrolase

Identical Sequences to LMP010213 proteins

Reference Database Accession Length Protein Name
GI:186532737 GenBank AAP83139.1 607 N-acylethanolamine amidohydrolase [Arabidopsis thaliana]
GI:186532737 gnl TAIR 607 fatty acid amide hydrolase [Arabidopsis thaliana]
GI:186532737 SwissProt Q7XJJ7.1 607 RecName: Full=Fatty acid amide hydrolase; AltName: Full=N-acylethanolamine amidohydrolase [Arabidopsis thaliana]

Related Sequences to LMP010213 proteins

Reference Database Accession Length Protein Name
GI:186532737 DBBJ BAB11605.1 607 unnamed protein product [Arabidopsis thaliana]
GI:186532737 GenBank AAF73891.1 607 amidase [Arabidopsis thaliana]
GI:186532737 GenBank ABZ49960.1 607 Sequence 2 from patent US 7316928
GI:186532737 GenBank EFH41161.1 607 N-acylethanolamine amidohydrolase [Arabidopsis lyrata subsp. lyrata]
GI:186532737 RefSeq XP_002864902.1 607 N-acylethanolamine amidohydrolase [Arabidopsis lyrata subsp. lyrata]
GI:186532737 RefSeq XP_006279853.1 607 hypothetical protein CARUB_v10028432mg [Capsella rubella]