Gene/Proteome Database (LMPD)

LMPD ID
LMP010178
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Ergosterol biosynthetic protein 28-like protein
Gene Symbol
Synonyms
homolog of yeast ergosterol28; T27I1.5; T27I1_5
Alternate Names
Ergosterol biosynthetic protein 28-like protein
Chromosome
1

Proteins

Ergosterol biosynthetic protein 28-like protein
Refseq ID NP_563858
Protein GI 18391101
UniProt ID O80594
mRNA ID NM_100877
Length 129
RefSeq Status REVIEWED
MKALGYWLMVVGSLRLASVWFGFFNIWALRLAVFSQTTMSEVHGRTFGVWTLLTCTLCFLCAFNLENKPLYLATFLSFIYALGHFLTEYLFYQTMTIANLSTVGFFAGTSIVWMLLEWNSLEQPHSKLS

Gene Information

Entrez Gene ID
Gene Name
Ergosterol biosynthetic protein 28-like protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR005352 Erg28

UniProt Annotations

Entry Information

Gene Name
Ergosterol biosynthetic protein 28-like protein
Protein Entry
ERG28_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Sequence Caution Sequence=AAC34343.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the ERG28 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010178 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18391101 RefSeq NP_563858 129 Ergosterol biosynthetic protein 28-like protein

Identical Sequences to LMP010178 proteins

Reference Database Accession Length Protein Name
GI:18391101 DBBJ BAE99721.1 129 hypothetical protein [Arabidopsis thaliana]
GI:18391101 GenBank AAP68212.1 129 At1g10030 [Arabidopsis thaliana]
GI:18391101 GenBank AEE28530.1 129 Ergosterol biosynthetic protein 28-like protein [Arabidopsis thaliana]
GI:18391101 SwissProt O80594.2 129 RecName: Full=Ergosterol biosynthetic protein 28 [Arabidopsis thaliana]

Related Sequences to LMP010178 proteins

Reference Database Accession Length Protein Name
GI:18391101 GenBank AAM62559.1 129 unknown [Arabidopsis thaliana]
GI:18391101 GenBank EFH66045.1 129 hypothetical protein ARALYDRAFT_471114 [Arabidopsis lyrata subsp. lyrata]
GI:18391101 GenBank ESQ35855.1 129 hypothetical protein EUTSA_v10009099mg [Eutrema salsugineum]
GI:18391101 RefSeq XP_002889786.1 129 hypothetical protein ARALYDRAFT_471114 [Arabidopsis lyrata subsp. lyrata]
GI:18391101 RefSeq XP_006417502.1 129 hypothetical protein EUTSA_v10009099mg [Eutrema salsugineum]
GI:18391101 RefSeq XP_010475865.1 129 PREDICTED: ergosterol biosynthetic protein 28 [Camelina sativa]