Gene/Proteome Database (LMPD)
Proteins
| diacylglycerol kinase 4 | |
|---|---|
| Refseq ID | NP_200577 |
| Protein GI | 145359366 |
| UniProt ID | Q1PDI2 |
| mRNA ID | NM_125152 |
| Length | 487 |
| RefSeq Status | REVIEWED |
| MESPSIGDSLTARMIPRHSSLDSFGAMKVSLLVNLASIRVSKAELRQRVMLPQYLRIAIRDCILRKDDSFDASSSVAPPLENNALTPEVPLMVFVNPKSGGRQGPLIKERLQNLISEEQVYDLTEVKPNEFIRYGLGCLEAFASRGDECAKEIREKMRIVVAGGDGTVGWVLGCLGELNLQNRLPVPPVSIMPLGTGNDLSRSFGWGGSFPFAWKSAIKRTLHRASVAPISRLDSWNILITMPSGEIVDPPYSLKATQECYIDQNLEIEGEIPPSTNGYEGVFYNYFSIGMDAQVAYGFHHLRNEKPYLANGPIANKIIYSGYGCSQGWFLTHCINDPGLRGLKNIMTLHIKKLDSSEWEKVPVPKSVRAVVALNLHSYGSGRNPWGNLKQDYLEKRGFVEAQADDGLLEIFGLKQGWHASFVMVELISAKHIAQAAAIRLEIRGGDWKDAFMQMDGEPWKQPMTRDYSTFVDIKRVPHQSLVVKGD | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol kinase 4
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0003951 | IEA:InterPro | F | NAD+ kinase activity |
| GO:0004143 | IEA:UniProtKB-EC | F | diacylglycerol kinase activity |
| GO:0006952 | IEA:UniProtKB-KW | P | defense response |
| GO:0007205 | IEA:InterPro | P | protein kinase C-activating G-protein coupled receptor signaling pathway |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2- diacyl-sn-glycerol 3-phosphate. |
| Function | Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule. PA is required for plant development and responses to abiotic stress and pathogen attack. May be involved in the accumulation of PA during cold stress (By similarity). {ECO:0000250}. |
| Sequence Caution | Sequence=BAB09587.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the eukaryotic diacylglycerol kinase family. {ECO:0000305}. |
| Similarity | Contains 1 DAGKc domain. {ECO:0000255|PROSITE- ProRule:PRU00783}. |
| Subunit | Monomer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010131 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145359366 | RefSeq | NP_200577 | 487 | diacylglycerol kinase 4 |
Identical Sequences to LMP010131 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145359366 | GenBank | ABE66256.1 | 487 | diacylglycerol kinase [Arabidopsis thaliana] |
| GI:145359366 | gnl | TAIR | 487 | diacylglycerol kinase 4 [Arabidopsis thaliana] |
| GI:145359366 | SwissProt | Q1PDI2.1 | 487 | RecName: Full=Diacylglycerol kinase 4; Short=AtDGK4; Short=DAG kinase 4; AltName: Full=Diglyceride kinase 4; Short=DGK 4 [Arabidopsis thaliana] |
Related Sequences to LMP010131 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145359366 | DBBJ | BAB09587.1 | 498 | diacylglycerol kinase-like protein [Arabidopsis thaliana] |
| GI:145359366 | GenBank | ACX06374.1 | 498 | Sequence 29895 from patent US 7569389 |
| GI:145359366 | GenBank | ACX06375.1 | 485 | Sequence 29896 from patent US 7569389 |
| GI:145359366 | GenBank | ACX06376.1 | 472 | Sequence 29897 from patent US 7569389 |
| GI:145359366 | GenBank | EFH42483.1 | 497 | hypothetical protein ARALYDRAFT_332060 [Arabidopsis lyrata subsp. lyrata] |
| GI:145359366 | RefSeq | XP_002866224.1 | 497 | hypothetical protein ARALYDRAFT_332060 [Arabidopsis lyrata subsp. lyrata] |