Gene/Proteome Database (LMPD)
Proteins
| diacylglycerol kinase 3 | |
|---|---|
| Refseq ID | NP_849980 |
| Protein GI | 30680460 |
| UniProt ID | Q8VZG1 |
| mRNA ID | NM_179649 |
| Length | 488 |
| RefSeq Status | REVIEWED |
| MDSPVSKTDASKEKFVASRPSTADSKTMRGCGLANLAWVGVDKVELRQRLMMPEYLRLAMRDCIKRKDSSAIPDHLLLPGGAVADMAPHAPMVVFINPNSGGRHGPVLKERLQQLMSEEQVFDLTEVKPHEFVRYGLGCLEKVAAEGDECAKECRARLRIMVAGGDGTVGWVLGCLGELNKDGKSQIPPVGVIPLGTGNDLSRSFGWGGSFPFAWRSAVKRTLHRASMGPVARLDSWKILVSMPSGEVVDPPYSLKPAEENELDQGLDAGIDAPPLAKAYEGVFYNYLSIGMDAQVAYGFHHLRNTKPYLAQGPISNKIIYSSFGCSQGWFCTPCVNDPGLRGLRNIMKIHIKKVNCSQWEEIAVPKNVRSIVALNLHSYGSGSHPWGNLKPDYLEKRGFVEAHCDDGLIEIFGFKQGWHASFVMAELISAKHIAQAAAVRFELRGGDWRDAFLQMDGEPWKQPMSTEYSTFVEIKKVPYQSLMINNE | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol kinase 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IDA:TAIR | C | membrane |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0009506 | IDA:TAIR | C | plasmodesma |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0003951 | IEA:InterPro | F | NAD+ kinase activity |
| GO:0004143 | IEA:UniProtKB-EC | F | diacylglycerol kinase activity |
| GO:0006952 | IEA:UniProtKB-KW | P | defense response |
| GO:0007205 | IEA:InterPro | P | protein kinase C-activating G-protein coupled receptor signaling pathway |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2- diacyl-sn-glycerol 3-phosphate. |
| Function | Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule. PA is required for plant development and responses to abiotic stress and pathogen attack. May be involved in the accumulation of PA during cold stress (By similarity). {ECO:0000250}. |
| Sequence Caution | Sequence=AAD08942.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the eukaryotic diacylglycerol kinase family. {ECO:0000305}. |
| Similarity | Contains 1 DAGKc domain. {ECO:0000255|PROSITE- ProRule:PRU00783}. |
| Subunit | Monomer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010130 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 30680460 | RefSeq | NP_849980 | 488 | diacylglycerol kinase 3 |
Identical Sequences to LMP010130 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30680460 | GenBank | AAL57635.1 | 488 | At2g18730/MSF3.11 [Arabidopsis thaliana] |
| GI:30680460 | GenBank | AAM98254.1 | 488 | At2g18730/MSF3.11 [Arabidopsis thaliana] |
| GI:30680460 | GenBank | AEC06799.1 | 488 | diacylglycerol kinase 3 [Arabidopsis thaliana] |
| GI:30680460 | SwissProt | Q8VZG1.1 | 488 | RecName: Full=Diacylglycerol kinase 3; Short=AtDGK3; Short=DAG kinase 3; AltName: Full=Diglyceride kinase 3; Short=DGK 3 [Arabidopsis thaliana] |
Related Sequences to LMP010130 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30680460 | GenBank | EFH60413.1 | 488 | hypothetical protein ARALYDRAFT_480776 [Arabidopsis lyrata subsp. lyrata] |
| GI:30680460 | GenBank | EOA30430.1 | 488 | hypothetical protein CARUB_v10013554mg [Capsella rubella] |
| GI:30680460 | RefSeq | XP_002884154.1 | 488 | hypothetical protein ARALYDRAFT_480776 [Arabidopsis lyrata subsp. lyrata] |
| GI:30680460 | RefSeq | XP_006297532.1 | 488 | hypothetical protein CARUB_v10013554mg [Capsella rubella] |
| GI:30680460 | RefSeq | XP_010414615.1 | 492 | PREDICTED: diacylglycerol kinase 3-like [Camelina sativa] |
| GI:30680460 | RefSeq | XP_010489588.1 | 492 | PREDICTED: diacylglycerol kinase 3 [Camelina sativa] |