Gene/Proteome Database (LMPD)

LMPD ID
LMP010122
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
delta-9 desaturase-like 2 protein
Gene Symbol
Synonyms
T21E18.15; T21E18_15
Alternate Names
delta-9 desaturase-like 2 protein
Chromosome
1
EC Number
1.14.19.-

Proteins

delta-9 desaturase-like 2 protein
Refseq ID NP_172100
Protein GI 15221395
UniProt ID Q9LND8
mRNA ID NM_100491
Length 299
RefSeq Status REVIEWED
MSETTKDDGSSQKKSVRKEKRAYVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFRFGIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTDYIREKCGRRNNVMDLKQQWFYRFLKKTLVLHILAFWTLIYLWGGLPYLTWTVGFGGVIGYHGTWLVNSACHICGSQAWQTNDTSRNVWWLALLTMGESWHNNHHAFETSARHGLEWYQLDITWYLIWFFQALGLATNVKLPTDAQKRKMAIRR

Gene Information

Entrez Gene ID
Gene Name
delta-9 desaturase-like 2 protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0006636 IEA:UniProtKB-UniPathway P unsaturated fatty acid biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-782 glycolipid desaturation

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR015876 Fatty acid desaturase, type 1, core

UniProt Annotations

Entry Information

Gene Name
delta-9 desaturase-like 2 protein
Protein Entry
ADSL2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}.
Pathway Lipid metabolism; polyunsaturated fatty acid biosynthesis.
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010122 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15221395 RefSeq NP_172100 299 delta-9 desaturase-like 2 protein

Identical Sequences to LMP010122 proteins

Reference Database Accession Length Protein Name
GI:15221395 GenBank AAF80133.1 299 Contains similarity to delta 9 desaturase mRNA and contains a fatty acid desaturase PF|01069 domain [Arabidopsis thaliana]
GI:15221395 GenBank AAT47784.1 299 At1g06100 [Arabidopsis thaliana]
GI:15221395 GenBank AAU94398.1 299 At1g06100 [Arabidopsis thaliana]
GI:15221395 GenBank AEE27939.1 299 delta-9 desaturase-like 2 protein [Arabidopsis thaliana]
GI:15221395 SwissProt Q9LND8.1 299 RecName: Full=Delta-9 desaturase-like 2 protein [Arabidopsis thaliana]

Related Sequences to LMP010122 proteins

Reference Database Accession Length Protein Name
GI:15221395 GenBank EFH65844.1 299 fatty acid desaturase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15221395 GenBank EFH65845.1 299 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:15221395 GenBank EOA38357.1 299 hypothetical protein CARUB_v10009877mg [Capsella rubella]
GI:15221395 RefSeq XP_002889585.1 299 fatty acid desaturase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15221395 RefSeq XP_002889586.1 299 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:15221395 RefSeq XP_006305459.1 299 hypothetical protein CARUB_v10009877mg [Capsella rubella]