Gene/Proteome Database (LMPD)
Proteins
| delta-9 desaturase-like 2 protein | |
|---|---|
| Refseq ID | NP_172100 |
| Protein GI | 15221395 |
| UniProt ID | Q9LND8 |
| mRNA ID | NM_100491 |
| Length | 299 |
| RefSeq Status | REVIEWED |
| MSETTKDDGSSQKKSVRKEKRAYVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFRFGIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTDYIREKCGRRNNVMDLKQQWFYRFLKKTLVLHILAFWTLIYLWGGLPYLTWTVGFGGVIGYHGTWLVNSACHICGSQAWQTNDTSRNVWWLALLTMGESWHNNHHAFETSARHGLEWYQLDITWYLIWFFQALGLATNVKLPTDAQKRKMAIRR | |
Gene Information
Entrez Gene ID
Gene Name
delta-9 desaturase-like 2 protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0006636 | IEA:UniProtKB-UniPathway | P | unsaturated fatty acid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-782 | glycolipid desaturation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta-9 desaturase-like 2 protein
Protein Entry
ADSL2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010122 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221395 | RefSeq | NP_172100 | 299 | delta-9 desaturase-like 2 protein |
Identical Sequences to LMP010122 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221395 | GenBank | AAF80133.1 | 299 | Contains similarity to delta 9 desaturase mRNA and contains a fatty acid desaturase PF|01069 domain [Arabidopsis thaliana] |
| GI:15221395 | GenBank | AAT47784.1 | 299 | At1g06100 [Arabidopsis thaliana] |
| GI:15221395 | GenBank | AAU94398.1 | 299 | At1g06100 [Arabidopsis thaliana] |
| GI:15221395 | GenBank | AEE27939.1 | 299 | delta-9 desaturase-like 2 protein [Arabidopsis thaliana] |
| GI:15221395 | SwissProt | Q9LND8.1 | 299 | RecName: Full=Delta-9 desaturase-like 2 protein [Arabidopsis thaliana] |
Related Sequences to LMP010122 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221395 | GenBank | EFH65844.1 | 299 | fatty acid desaturase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221395 | GenBank | EFH65845.1 | 299 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221395 | GenBank | EOA38357.1 | 299 | hypothetical protein CARUB_v10009877mg [Capsella rubella] |
| GI:15221395 | RefSeq | XP_002889585.1 | 299 | fatty acid desaturase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221395 | RefSeq | XP_002889586.1 | 299 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221395 | RefSeq | XP_006305459.1 | 299 | hypothetical protein CARUB_v10009877mg [Capsella rubella] |