Gene/Proteome Database (LMPD)
LMPD ID
LMP010039
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphorylcholine cytidylyltransferase2
Gene Symbol
Synonyms
ATCCT2; CCT2; DL3610W; FCAALL.209; phosphorylcholine cytidylyltransferase2
Alternate Names
phosphorylcholine cytidylyltransferase2
Chromosome
4
EC Number
2.7.7.15
Proteins
| phosphorylcholine cytidylyltransferase2 | |
|---|---|
| Refseq ID | NP_193249 |
| Protein GI | 240255851 |
| UniProt ID | F4JJE0 |
| mRNA ID | NM_117602 |
| Length | 304 |
| RefSeq Status | REVIEWED |
| MSVNGENKVSGGDSSSSDRPVRVYADGIFDLFHFGHARAIEQAKKSFPNTYLLVGCCNDEITNKFKGKTVMTESERYESLRHCKWVDEVIPDAPWVLTTEFLDKHKIDYVAHDALPYADTSGAGNDVYEFVKSIGKFKETKRTEGISTSDIIMRIVKDYNQYVLRNLDRGYSREELGVSFEEKRLRVNMRLKKLQEKVKEQQEKIQTVAKTAGMHHDEWLENADRWVAGFLEMFEEGCHKMGTAIRDGIQQRLMRQESEENRRLLQNGLTISKDNDDEQMSDDNEFAEEDCVNVSNKGIETVKK | |
Gene Information
Entrez Gene ID
Gene Name
phosphorylcholine cytidylyltransferase2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0004105 | IMP:TAIR | F | choline-phosphate cytidylyltransferase activity |
| GO:0006657 | IMP:GOC | P | CDP-choline pathway |
| GO:0006656 | IMP:TAIR | P | phosphatidylcholine biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphorylcholine cytidylyltransferase2
Protein Entry
CCT2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Temperature dependence: Optimum temperature is 30 degrees Celsius. {ECO:0000269|PubMed:12461134}; |
| Catalytic Activity | CTP + phosphocholine = diphosphate + CDP- choline. |
| Disruption Phenotype | No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:19667100}. |
| Function | Plays an important role in the biosynthesis of the phospholipid phosphatidylcholine. Catalyzes the formation of CDP- choline. {ECO:0000269|PubMed:19667100}. |
| Induction | By cold treatment. {ECO:0000269|PubMed:12461134}. |
| Pathway | Phospholipid metabolism; phosphatidylcholine biosynthesis; phosphatidylcholine from phosphocholine: step 1/2. |
| Sequence Caution | Sequence=CAB45996.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB78555.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the cytidylyltransferase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010039 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 240255851 | RefSeq | NP_193249 | 304 | phosphorylcholine cytidylyltransferase2 |
Identical Sequences to LMP010039 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:240255851 | GenBank | AEE83559.1 | 304 | phosphorylcholine cytidylyltransferase2 [Arabidopsis thaliana] |
| GI:240255851 | SwissProt | F4JJE0.1 | 304 | RecName: Full=Choline-phosphate cytidylyltransferase 2; Short=AtCCT2; AltName: Full=CTP:phosphocholine cytidylyltransferase 2; AltName: Full=Phosphorylcholine transferase 2 [Arabidopsis thaliana] |
Related Sequences to LMP010039 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:240255851 | DBBJ | BAC01276.1 | 305 | CTP:phosphorylcholine cytidylyltransferase [Arabidopsis thaliana] |
| GI:240255851 | DBBJ | BAC01277.1 | 305 | CTP:phosphorylcholine cytidylyltransferase [Arabidopsis thaliana] |
| GI:240255851 | EMBL | CAY05210.1 | 305 | unnamed protein product [Arabidopsis thaliana] |
| GI:240255851 | EMBL | CBF65920.1 | 305 | unnamed protein product [Arabidopsis thaliana] |
| GI:240255851 | EMBL | CBU90792.1 | 305 | unnamed protein product [Arabidopsis thaliana] |
| GI:240255851 | GenBank | AGX57884.1 | 305 | Sequence 16069 from patent US 8541208 |