Gene/Proteome Database (LMPD)

LMPD ID
LMP009978
Gene ID
841709
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lysophospholipase 2
Gene Symbol
LysoPL2
Synonyms
F14G24.3; F14G24_3; lysophospholipase 2; LysoPL2
Alternate Names
lysophospholipase 2
Chromosome
1
EC Number
3.1.1.-
Summary
Encodes a lysophospholipase 2 (LysoPL2). Involved in tolerance to cadmium-induced oxidative stress. Binds Acyl-CoA-binding protein 2 (ACBP2).
Orthologs
View orthologs and multiple alignments for LysoPL2

Proteins

lysophospholipase 2
Refseq ID NP_175685
Protein GI 15219082
UniProt ID Q9C942
mRNA ID NM_104154
Length 332
RefSeq Status REVIEWED
MPSEAESSANSAPATPPPPPNFWGTMPEEEYYTSQGVRNSKSYFETPNGKLFTQSFLPLDGEIKGTVYMSHGYGSDTSWMFQKICMSFSSWGYAVFAADLLGHGRSDGIRCYMGDMEKVAATSLAFFKHVRCSDPYKDLPAFLFGESMGGLVTLLMYFQSEPETWTGLMFSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQRYTGKPRVGTMRELLRKTQYVQENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSLIQGEPDENAEIVLKDMREWIDEKVKKYGSKTA

Gene Information

Entrez Gene ID
841709
Gene Name
lysophospholipase 2
Gene Symbol
LysoPL2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005886 IDA:TAIR C plasma membrane
GO:0009506 IDA:TAIR C plasmodesma
GO:0003846 IDA:TAIR F 2-acylglycerol O-acyltransferase activity
GO:0016787 IDA:TAIR F hydrolase activity
GO:0004622 IDA:TAIR F lysophospholipase activity
GO:0009809 IEA:UniProtKB-KW P lignin biosynthetic process
GO:0046686 IMP:TAIR P response to cadmium ion
GO:0042542 IMP:TAIR P response to hydrogen peroxide
GO:0006979 IMP:TAIR P response to oxidative stress
GO:0010043 IEP:TAIR P response to zinc ion

KEGG Pathway Links

KEGG Pathway ID Description
ath_M00039 Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
ath00940 Phenylpropanoid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254309 Acyl chain remodeling of DAG and TAG
6254185 Arachidonate production from DAG

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold

UniProt Annotations

Entry Information

Gene Name
lysophospholipase 2
Protein Entry
CSE_ARATH
UniProt ID
Q9C942
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=96.5 uM for caffeoylshikimate {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498}; KM=211 uM for 4-coumarylshikimate {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498}; KM=6.6 uM for lysophosphatidylcholine (at pH 8.0 and 33 degrees Celsius) {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498}; Vmax=9.3 pmol/sec/mg enzyme toward caffeoylshikimate {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498}; Vmax=0.66 pmol/sec/mg enzyme toward 4-coumarylshikimate {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498}; Vmax=0.030 umol/min/mg enzyme toward lysophosphatidylcholine (at pH 8.0 and 33 degrees Celsius) {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498};
Catalytic Activity Caffeoylshikimate + H(2)O = caffeate + shikimate. {ECO:0000269|PubMed:23950498}.
Disruption Phenotype Reduced height and weight of senescent plants due to reduced lignin content. {ECO:0000269|PubMed:23950498}.
Function Esterase involved in the biosynthesis of lignin. Hydrolyzes caffeoylshikimate into caffeate and shikimate. Together with 4-coumarate--CoA ligase (4CL), acts on an alternative reaction for the formation of caffeoyl-CoA and bypasses the second reaction of shikimate O-hydroxycinnamoyltransferase (HST). Accepts also 4-coumaroylshikimate as substrate, but with lower activity. According to PubMed:20345607 and PubMed:22915575, posseses monoacylglycerol O-acyltransferase, monoacylglycerol lipase and lysophospholipase activities in vitro. With the association of ACBP2, may promote the degradation of lysophosphatidylcholine and detoxify the peroxidized membrane in response to cadmium-induced oxidative stress. However these results require additional confirmation in vivo. {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:20657176, ECO:0000269|PubMed:22915575, ECO:0000269|PubMed:23950498}.
Induction By zinc and H(2)O(2). {ECO:0000269|PubMed:20345607}.
Miscellaneous Mutant plants exhibit increased sensitivity to zinc, cadmium and H(2)O(2). {ECO:0000305|PubMed:20345607}.
Similarity Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family. {ECO:0000305}.
Subcellular Location Cell membrane {ECO:0000305|PubMed:20345607}; Peripheral membrane protein {ECO:0000305|PubMed:20345607}. Note=Colocalizes with ACBP2.
Subunit Interacts with ACBP2. {ECO:0000269|PubMed:20345607}.
Tissue Specificity Expressed in vasculature of roots and leaves, stems, flowers and siliques. {ECO:0000269|PubMed:20345607, ECO:0000269|PubMed:23950498}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009978 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15219082 RefSeq NP_175685 332 lysophospholipase 2

Identical Sequences to LMP009978 proteins

Reference Database Accession Length Protein Name
GI:15219082 EMBL CBD32241.1 332 unnamed protein product [Arabidopsis thaliana]
GI:15219082 EMBL CBC65023.1 332 unnamed protein product [Arabidopsis thaliana]
GI:15219082 EMBL CBD25930.1 332 unnamed protein product [Arabidopsis thaliana]
GI:15219082 EMBL CBD05753.1 332 unnamed protein product [Arabidopsis thaliana]
GI:15219082 EMBL CBK51658.1 332 unnamed protein product [Arabidopsis thaliana]
GI:15219082 GenBank AEE32849.1 332 lysophospholipase 2 [Arabidopsis thaliana]

Related Sequences to LMP009978 proteins

Reference Database Accession Length Protein Name
GI:15219082 GenBank EOA39092.1 322 hypothetical protein CARUB_v10011835mg [Capsella rubella]
GI:15219082 GenBank ESQ30158.1 328 hypothetical protein EUTSA_v10011645mg [Eutrema salsugineum]
GI:15219082 RefSeq XP_006306194.1 322 hypothetical protein CARUB_v10011835mg [Capsella rubella]
GI:15219082 RefSeq XP_006392872.1 328 hypothetical protein EUTSA_v10011645mg [Eutrema salsugineum]
GI:15219082 RefSeq XP_010500894.1 329 PREDICTED: caffeoylshikimate esterase [Camelina sativa]
GI:15219082 RefSeq XP_010479797.1 329 PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]