Gene/Proteome Database (LMPD)
LMPD ID
LMP009974
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Gene Symbol
Synonyms
HYDRA1
Alternate Names
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Chromosome
1
EC Number
5.3.3.5
Summary
C-8 sterol isomerase
Orthologs
Proteins
| probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | |
|---|---|
| Refseq ID | NP_173433 |
| Protein GI | 15223758 |
| UniProt ID | Q0WRA8 |
| mRNA ID | NM_101859 |
| Length | 223 |
| RefSeq Status | REVIEWED |
| MEELAHPYVPRDLNLPGYVPISMSMSSIVSIYLGSSLLVVSLVWLLFGRKKAKLDKLLMCWWTFTGLTHVILEGYFVFSPEFFKDNTSAYLAEVWKEYSKGDSRYVGRDSAVVSVEGITAVIVGPASLLAIYAIAKEKSYSYVLQLAISVCQLYGCLVYFITAILEGDNFATNSFYYYSYYIGANCWWVLIPSLISFRCWKKICAAAAIANNNVETKTKKKTR | |
Gene Information
Entrez Gene ID
Gene Name
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0000247 | IMP:TAIR | F | C-8 sterol isomerase activity |
| GO:0047750 | IEA:UniProtKB-EC | F | cholestenol delta-isomerase activity |
| GO:0060964 | IMP:TAIR | P | regulation of gene silencing by miRNA |
| GO:0016126 | TAS:TAIR | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath01100 | Metabolic pathways |
| ath00100 | Steroid biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6254036 | Cholesterol biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007905 | Emopamil-binding protein |
UniProt Annotations
Entry Information
Gene Name
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Protein Entry
EBP_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 5-alpha-cholest-7-en-3-beta-ol = 5-alpha- cholest-8-en-3-beta-ol. |
| Function | Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers. {ECO:0000250}. |
| Pathway | Steroid biosynthesis; sterol biosynthesis. |
| Similarity | Belongs to the EBP family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009974 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15223758 | RefSeq | NP_173433 | 223 | probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase |
Identical Sequences to LMP009974 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15223758 | GenBank | ACW93529.1 | 223 | Sequence 12418 from patent US 7569389 |
| GI:15223758 | GenBank | ACW94001.1 | 223 | Sequence 13057 from patent US 7569389 |
| GI:15223758 | GenBank | ACX05444.1 | 223 | Sequence 28633 from patent US 7569389 |
| GI:15223758 | GenBank | ACX16624.1 | 223 | Sequence 43815 from patent US 7569389 |
| GI:15223758 | GenBank | ACX21375.1 | 223 | Sequence 50236 from patent US 7569389 |
| GI:15223758 | GenBank | AEE29928.1 | 223 | probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase [Arabidopsis thaliana] |
Related Sequences to LMP009974 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15223758 | GenBank | AAD04752.1 | 223 | phenylalkylamine binding protein homolog [Arabidopsis thaliana] |
| GI:15223758 | GenBank | ACW94197.1 | 223 | Sequence 13322 from patent US 7569389 |
| GI:15223758 | GenBank | ACX08060.1 | 223 | Sequence 32180 from patent US 7569389 |
| GI:15223758 | GenBank | ACX18545.1 | 223 | Sequence 46414 from patent US 7569389 |
| GI:15223758 | GenBank | AEL84744.1 | 223 | Sequence 90 from patent US 7989676 |
| GI:15223758 | GenBank | AGF14090.1 | 223 | Sequence 13509 from patent US 8362325 |