Gene/Proteome Database (LMPD)

LMPD ID
LMP009868
Gene ID
838176
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
AP2-like ethylene-responsive transcription factor
Gene Symbol
ADAP
Synonyms
ARIA-interacting double AP2 domain protein; T24D18.16; T24D18_16
Alternate Names
AP2-like ethylene-responsive transcription factor
Chromosome
1
Summary
Encodes ADAP, an AP2-domain protein that interacts with ARIA. ADAP is a positive regulator of the ABA response and is also involved in regulating seedling growth.
Orthologs
View orthologs and multiple alignments for ADAP

Proteins

AP2-like ethylene-responsive transcription factor
Refseq ID NP_973839
Protein GI 42571497
UniProt ID Q94AN4
mRNA ID NM_202110
Length 275
RefSeq Status REVIEWED
MFFFLVLLTMLTGIMADSSRAVYLGAYDEEDAAARAYDLAALKYWGRDTILNFPLCNYEEDIKEMESQSKEEYIGSLRRKSSGFSRGVSKYRGVAKHHHNGRWEARIGRVFGNKYLYLGTYATQEEAAIAYDIAAIEYRGLNAVTNFDISRYLKLPVPENPIDTANNLLESPHSDLSPFIKPNHESDLSQSQSSSEDNDDRKTKLLKSSPLVAEEVIGPSTPPEIAPPRRSFPEDIQTYFGCQNSGKLTAEEDDVIFGDLDSFLTPDFYSELNDC
AP2-like ethylene-responsive transcription factor
Refseq ID NP_563990
Protein GI 18394319
UniProt ID Q94AN4
mRNA ID NM_101474
Length 345
RefSeq Status REVIEWED
MFIAVEVSPVMEDITRQSKKTSVENETGDDQSATSVVLKAKRKRRSQPRDAPPQRSSVHRGVTRHRWTGRYEAHLWDKNSWNETQTKKGRQVYLGAYDEEDAAARAYDLAALKYWGRDTILNFPLCNYEEDIKEMESQSKEEYIGSLRRKSSGFSRGVSKYRGVAKHHHNGRWEARIGRVFGNKYLYLGTYATQEEAAIAYDIAAIEYRGLNAVTNFDISRYLKLPVPENPIDTANNLLESPHSDLSPFIKPNHESDLSQSQSSSEDNDDRKTKLLKSSPLVAEEVIGPSTPPEIAPPRRSFPEDIQTYFGCQNSGKLTAEEDDVIFGDLDSFLTPDFYSELNDC

Gene Information

Entrez Gene ID
838176
Gene Name
AP2-like ethylene-responsive transcription factor
Gene Symbol
ADAP
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0003677 IEA:UniProtKB-KW F DNA binding
GO:0000981 IPI:TAIR F sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0003700 ISS:TAIR F sequence-specific DNA binding transcription factor activity
GO:0009873 IEA:UniProtKB-KW P ethylene-activated signaling pathway
GO:0010187 IMP:TAIR P negative regulation of seed germination
GO:1901959 IGI:TAIR P positive regulation of cutin biosynthetic process
GO:0045723 IMP:TAIR P positive regulation of fatty acid biosynthetic process
GO:0040008 IMP:TAIR P regulation of growth
GO:0006357 IPI:GOC P regulation of transcription from RNA polymerase II promoter
GO:0009737 IMP:TAIR P response to abscisic acid
GO:0009651 IMP:TAIR P response to salt stress
GO:0009414 IMP:TAIR P response to water deprivation
GO:0006366 IPI:GOC P transcription from RNA polymerase II promoter

Domain Information

InterPro Annotations

Accession Description
IPR001471 AP2/ERF domain
IPR016177 DNA-binding domain

UniProt Annotations

Entry Information

Gene Name
AP2-like ethylene-responsive transcription factor
Protein Entry
AP2L1_ARATH
UniProt ID
Q94AN4
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q94AN4-1; Sequence=Displayed; Name=2; IsoId=Q94AN4-2; Sequence=VSP_026147, VSP_026148; Note=Derived from EST data. No experimental confirmation available.;
Function Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Sequence Caution Sequence=AAF18503.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the AP2/ERF transcription factor family. AP2 subfamily. {ECO:0000305}.
Similarity Contains 2 AP2/ERF DNA-binding domains. {ECO:0000255|PROSITE-ProRule:PRU00366}.
Subcellular Location Nucleus {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009868 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18394319 RefSeq NP_563990 345 AP2-like ethylene-responsive transcription factor
42571497 RefSeq NP_973839 275 AP2-like ethylene-responsive transcription factor

Identical Sequences to LMP009868 proteins

Reference Database Accession Length Protein Name
GI:18394319 GenBank AAK76589.1 345 unknown protein [Arabidopsis thaliana]
GI:18394319 GenBank AAM91814.1 345 unknown protein [Arabidopsis thaliana]
GI:18394319 GenBank ABN28070.1 345 Sequence 528 from patent US 7157621
GI:18394319 GenBank ACX15557.1 345 Sequence 42368 from patent US 7569389
GI:42571497 GenBank AEE29404.1 275 AP2-like ethylene-responsive transcription factor [Arabidopsis thaliana]
GI:18394319 GenBank AEE29405.1 345 AP2-like ethylene-responsive transcription factor [Arabidopsis thaliana]
GI:18394319 SwissProt Q94AN4.1 345 RecName: Full=AP2-like ethylene-responsive transcription factor At1g16060 [Arabidopsis thaliana]

Related Sequences to LMP009868 proteins

Reference Database Accession Length Protein Name
GI:42571497 GenBank AAM91814.1 345 unknown protein [Arabidopsis thaliana]
GI:42571497 GenBank ABN28070.1 345 Sequence 528 from patent US 7157621
GI:18394319 GenBank ACC29269.1 352 Sequence 1900 from patent US 7345217
GI:42571497 GenBank ACX15557.1 345 Sequence 42368 from patent US 7569389
GI:18394319 GenBank ADF13018.1 352 Sequence 676 from patent US 7663025
GI:18394319 GenBank ADS94158.1 352 Sequence 358 from patent US 7825296
GI:42571497 GenBank AEE29405.1 345 AP2-like ethylene-responsive transcription factor [Arabidopsis thaliana]
GI:18394319 GenBank AEI23319.1 352 Sequence 1570 from patent US 7960612
GI:18394319 GenBank AEQ40642.1 352 Sequence 1362 from patent US 8030546
GI:18394319 GenBank AGX49249.1 352 Sequence 358 from patent US 8541665
GI:42571497 RefSeq NP_563990.1 345 AP2-like ethylene-responsive transcription factor [Arabidopsis thaliana]
GI:42571497 SwissProt Q94AN4.1 345 RecName: Full=AP2-like ethylene-responsive transcription factor At1g16060 [Arabidopsis thaliana]