Gene/Proteome Database (LMPD)

LMPD ID
LMP009780
Gene ID
840069
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl-CoA-binding protein 6
Gene Symbol
ACBP6
Synonyms
ACBP; ACBP6; ACYL-COA-BINDING PROTEIN; acyl-CoA-binding protein 6; F5M6.27; F5M6_27
Alternate Names
acyl-CoA-binding protein 6
Chromosome
1
Summary
Acyl-CoA-binding protein. Bind acyl-CoA esters and protect acyl-CoAs from degradation by microsomal acyl-hydrolases.
Orthologs
View orthologs and multiple alignments for ACBP6

Proteins

acyl-CoA-binding protein 6
Refseq ID NP_174462
Protein GI 15222465
UniProt ID P57752
mRNA ID NM_102916
Length 92
RefSeq Status REVIEWED
MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAASKAST

Gene Information

Entrez Gene ID
840069
Gene Name
acyl-CoA-binding protein 6
Gene Symbol
ACBP6
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:TAIR C cytosol
GO:0005886 IDA:TAIR C plasma membrane
GO:0000062 IDA:TAIR F fatty-acyl-CoA binding
GO:0031210 IDA:TAIR F phosphatidylcholine binding
GO:0006869 IDA:TAIR P lipid transport
GO:0009646 TAS:UniProtKB P response to absence of light
GO:0009409 IEP:TAIR P response to cold
GO:0050826 IMP:TAIR P response to freezing

Domain Information

InterPro Annotations

Accession Description
IPR000582 Acyl-CoA-binding protein, ACBP
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle

UniProt Annotations

Entry Information

Gene Name
acyl-CoA-binding protein 6
Protein Entry
ACBP6_ARATH
UniProt ID
P57752
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype Enhanced sensitivity to freezing stress. {ECO:0000269|PubMed:18621979}.
Function Binds medium- and long-chain acyl-CoA esters with very high affinity. May function as an intracellular carrier of acyl- CoA esters. Confers resistance to cold and freezing. Interacts with phosphatidylcholine and derivatives, but not phosphatidic acid and lysophosphatidylcholine. May be involved in phospholipid metabolism. {ECO:0000269|PubMed:18621979, ECO:0000269|PubMed:8660683}.
Induction Up-regulated in constant darkness and down-regulated in the light. Induced by cold (at protein level). {ECO:0000269|PubMed:18621979}.
Similarity Belongs to the ACBP family. {ECO:0000305}.
Similarity Contains 1 ACB (acyl-CoA-binding) domain. {ECO:0000255|PROSITE-ProRule:PRU00573}.
Subcellular Location Cytoplasm {ECO:0000269|PubMed:18621979}.
Tissue Specificity Mostly expressed in seeds, stems, and siliques, and, to a lower extent, in leaves, flowers, and roots (at protein level). {ECO:0000269|PubMed:18621979, ECO:0000269|PubMed:8660683}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009780 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15222465 RefSeq NP_174462 92 acyl-CoA-binding protein 6

Identical Sequences to LMP009780 proteins

Reference Database Accession Length Protein Name
GI:15222465 GenBank AAL06793.1 92 At1g31820/F5M6_26 [Arabidopsis thaliana]
GI:15222465 GenBank ACX16922.1 92 Sequence 44218 from patent US 7569389
GI:15222465 GenBank ACX20135.1 92 Sequence 48559 from patent US 7569389
GI:15222465 GenBank AED37543.1 92 Sequence 26 from patent US 7880053
GI:15222465 GenBank AEE31396.1 92 acyl-CoA-binding protein 6 [Arabidopsis thaliana]
GI:15222465 GenBank AGM75091.1 92 Sequence 3 from patent US 8378172

Related Sequences to LMP009780 proteins

Reference Database Accession Length Protein Name
GI:15222465 GenBank AAM65863.1 93 Acyl CoA binding protein, putative [Arabidopsis thaliana]
GI:15222465 GenBank EFH69947.1 90 acyl-CoA-binding protein [Arabidopsis lyrata subsp. lyrata]
GI:15222465 GenBank AGM75092.1 167 Sequence 5 from patent US 8378172
GI:15222465 GenBank AGM75093.1 334 Sequence 7 from patent US 8378172
GI:15222465 RefSeq XP_002893688.1 90 acyl-CoA-binding protein [Arabidopsis lyrata subsp. lyrata]
GI:15222465 SwissProt Q39315.1 92 RecName: Full=Acyl-CoA-binding protein; Short=ACBP [Brassica napus]