Gene/Proteome Database (LMPD)

LMPD ID
LMP009759
Gene ID
819664
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 1
Gene Symbol
ACP1
Synonyms
ACP; ACP1; ACYL CARRIER PROTEIN; acyl carrier protein 1; T9J14.3; T9J14_3
Alternate Names
acyl carrier protein 1
Chromosome
3
Summary
encodes an acyl carrier protein expressed in leaves, roots, and dry seeds. Protein is not regulated by light.
Orthologs
View orthologs and multiple alignments for ACP1

Proteins

acyl carrier protein 1
Refseq ID NP_187153
Protein GI 15229875
UniProt ID Q0WT41
mRNA ID NM_111374
Length 137
RefSeq Status REVIEWED
MATQFSASVSLQTSCLATTRISFQKPALISNHGKTNLSFNLRRSIPSRRLSVSCAAKQETIEKVSAIVKKQLSLTPDKKVVAETKFADLGADSLDTVEIVMGLEEEFNIQMAEEKAQKIATVEQAAELIEELINEKK

Gene Information

Entrez Gene ID
819664
Gene Name
acyl carrier protein 1
Gene Symbol
ACP1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0005829 IDA:TAIR C cytosol
GO:0000036 IDA:TAIR F ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process
GO:0006633 TAS:TAIR P fatty acid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
acyl carrier protein 1
Protein Entry
ACP1_ARATH
UniProt ID
Q0WT41
Species
Arabidopsis

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000269|PubMed:11553750}.
Miscellaneous Plants over-expressing ACP1 show altered composition of fatty acids, with significant decrease in levels of hexadecatrienoic acid (16:3) and increase in linolenate (18:3) content. {ECO:0000305|PubMed:11553750}.
Ptm 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by acpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group (By similarity). {ECO:0000250}.
Similarity Contains 1 acyl carrier domain. {ECO:0000305}.
Subcellular Location Plastid, chloroplast.

Identical and Related Proteins

Unique RefSeq proteins for LMP009759 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15229875 RefSeq NP_187153 137 acyl carrier protein 1

Identical Sequences to LMP009759 proteins

Reference Database Accession Length Protein Name
GI:15229875 DBBJ BAE99707.1 137 acyl carrier protein 1 precursor [Arabidopsis thaliana]
GI:15229875 GenBank AAP21205.1 137 At3g05020 [Arabidopsis thaliana]
GI:15229875 GenBank ABL51183.1 137 Sequence 24 from patent US 7135618
GI:15229875 GenBank AEE74176.1 137 acyl carrier protein 1 [Arabidopsis thaliana]
GI:15229875 GenBank AFO16628.1 137 Sequence 24 from patent US 8212111
GI:15229875 GenBank AGU26039.1 137 Sequence 24 from patent US 8492612

Related Sequences to LMP009759 proteins

Reference Database Accession Length Protein Name
GI:15229875 GenBank EFH60745.1 137 hypothetical protein ARALYDRAFT_477783 [Arabidopsis lyrata subsp. lyrata]
GI:15229875 PRF - 137 acyl carrier protein 1 [Arabidopsis thaliana]
GI:15229875 RefSeq XP_002884486.1 137 hypothetical protein ARALYDRAFT_477783 [Arabidopsis lyrata subsp. lyrata]
GI:15229875 RefSeq XP_010421939.1 134 PREDICTED: acyl carrier protein 1, chloroplastic-like [Camelina sativa]
GI:15229875 RefSeq XP_010464003.1 134 PREDICTED: acyl carrier protein 1, chloroplastic [Camelina sativa]
GI:15229875 RefSeq XP_010485898.1 134 PREDICTED: acyl carrier protein 1, chloroplastic-like [Camelina sativa]