Gene/Proteome Database (LMPD)

LMPD ID
LMP009713
Gene ID
819779
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketodihydrosphinganine reductase-like protein
Gene Symbol
AT3G06060
Synonyms
F24F17.4; F24F17_4
Alternate Names
3-ketodihydrosphinganine reductase-like protein
Chromosome
3
EC Number
1.1.1.102

Proteins

3-ketodihydrosphinganine reductase-like protein
Refseq ID NP_187257
Protein GI 30679701
UniProt ID Q0WRJ2
mRNA ID NM_111481
Length 326
RefSeq Status REVIEWED
MAAISPLFLLFLIPIIPLSLLAILALIVRPRPIKIPIKSRHAFITGGSSGIGLALAHRAASEGARVSILARSGSKLEEAKKSIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELVKHSPEDVKFTIDVNLVGSFNVIKAALPAMKARKDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQQEVISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAIIAASSGSMETEEVAKKAMDGIKAGNFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYKAIEKWSKTKTK

Gene Information

Entrez Gene ID
819779
Gene Name
3-ketodihydrosphinganine reductase-like protein
Gene Symbol
AT3G06060
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:TAIR C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047560 IDA:TAIR F 3-dehydrosphinganine reductase activity
GO:0030148 IMP:TAIR P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
6254191 Sphingolipid de novo biosynthesis
6254192 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
3-ketodihydrosphinganine reductase-like protein
Protein Entry
TC10A_ARATH
UniProt ID
Q0WRJ2
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Sphinganine + NADP(+) = 3-dehydrosphinganine + NADPH. {ECO:0000269|PubMed:21421810}.
Disruption Phenotype High frequency of tricotyledons and altered flower morphology. The double mutants tsc10a and tsc10b are not viable. {ECO:0000269|PubMed:21421810}.
Function Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS). Required for sphingolipid biosynthesis. In plants, sphingolipids seems to play a critical role in mineral ion homeostasis, most likely through their involvement in the ion transport functionalities of membrane systems in the root. Lacks stereospecificity and can also produce L-threo-DHS in addition to D-erythro-DHS. {ECO:0000269|PubMed:21421810}.
Pathway Lipid metabolism; sphingolipid metabolism.
Sequence Caution Sequence=AAF66134.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAO24564.1; Type=Miscellaneous discrepancy; Note=Sequencing errors.; Evidence={ECO:0000305};
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305|PubMed:21421810}; Multi-pass membrane protein {ECO:0000305|PubMed:21421810}.
Tissue Specificity Expressed in roots, leaves, stems, flowers and siliques. {ECO:0000269|PubMed:21421810}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009713 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30679701 RefSeq NP_187257 326 3-ketodihydrosphinganine reductase-like protein

Identical Sequences to LMP009713 proteins

Reference Database Accession Length Protein Name
GI:30679701 DBBJ BAF00257.1 326 hypothetical protein [Arabidopsis thaliana]
GI:30679701 GenBank AEE74338.1 326 3-ketodihydrosphinganine reductase-like protein [Arabidopsis thaliana]
GI:30679701 SwissProt Q0WRJ2.1 326 RecName: Full=3-dehydrosphinganine reductase TSC10A; AltName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; AltName: Full=3-ketosphinganine reductase [Arabidopsis thaliana]

Related Sequences to LMP009713 proteins

Reference Database Accession Length Protein Name
GI:30679701 GenBank AAF66134.1 327 unknown protein; 15741-13972 [Arabidopsis thaliana]
GI:30679701 GenBank AAO24564.1 327 At3g06060 [Arabidopsis thaliana]
GI:30679701 GenBank EFH60815.1 326 short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata]
GI:30679701 RefSeq XP_002884556.1 326 short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata]
GI:30679701 RefSeq XP_010435653.1 345 PREDICTED: 3-dehydrosphinganine reductase TSC10A isoform X2 [Camelina sativa]
GI:30679701 RefSeq XP_010486091.1 342 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Camelina sativa]