Gene/Proteome Database (LMPD)

LMPD ID
LMP009669
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Gene Symbol
Synonyms
2C-METHYL-D-ERYTHRITOL 2; 4-CYCLODIPHOSPHATE SYNTHASE; isoprenoid F; ISPF; MECPS; T12P18.1; T12P18_1
Alternate Names
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Chromosome
1
EC Number
4.6.1.12
Summary
Encodes a protein with 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity. The protein's activity was confirmed by heterologous expression of phenotypic complementation of the E. coli ispF mutant. Plants defective in this gene display an albino lethal phenotype.Homolog of E. coli IspF
Orthologs

Proteins

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Refseq ID NP_850971
Protein GI 30696936
UniProt ID Q9CAK8
mRNA ID NM_180640
Length 231
RefSeq Status REVIEWED
MATSSTQLLLSSSSLFHSQITKKPFLLPATKIGVWRPKKSLSLSCRPSASVSAASSAVDVNESVTSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Refseq ID NP_564819
Protein GI 22330411
UniProt ID Q9CAK8
mRNA ID NM_105070
Length 223
RefSeq Status REVIEWED
MATSSTQLLLSSSSLFHSQITKKPFLLPATKIGVWRPKKSLSLSCRPSASVSAASSAVDVNESVTSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAHSDVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK

Gene Information

Entrez Gene ID
Gene Name
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0009570 IDA:TAIR C chloroplast stroma
GO:0008685 IGI:TAIR F 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0016117 IMP:TAIR P carotenoid biosynthetic process
GO:0015995 IMP:TAIR P chlorophyll biosynthetic process
GO:0019288 IEA:UniProtKB-UniPathway P isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath_M00096 C5 isoprenoid biosynthesis, non-mevalonate pathway
ath01100 Metabolic pathways
ath00900 Terpenoid backbone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR003526 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
IPR020555 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, conserved site

UniProt Annotations

Entry Information

Gene Name
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Protein Entry
ISPF_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9CAK8-1; Sequence=Displayed; Name=2; IsoId=Q9CAK8-2; Sequence=VSP_009112; Note=May be due to a competing acceptor splice site. No experimental confirmation available.;
Catalytic Activity 2-phospho-4-(cytidine 5'-diphospho)-2-C- methyl-D-erythritol = 2-C-methyl-D-erythritol 2,4-cyclodiphosphate + CMP.
Cofactor Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240; Evidence={ECO:0000269|PubMed:17660251}; Note=Binds 1 divalent metal cation per subunit. {ECO:0000269|PubMed:17660251};
Disruption Phenotype Albino phenotype and seedling lethal when homozygous. The phenotype is caused by an early arrest in chloroplast differentiation. {ECO:0000269|PubMed:16231155}.
Function Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 4-diphosphocytidyl-2C- methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4- cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C- methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP. Is essential for chloroplast development. {ECO:0000269|PubMed:16231155}.
Induction Circadian-regulated with a peak in the late period of dark phase and early period of the light phase. {ECO:0000269|PubMed:15863698}.
Pathway Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via DXP pathway; isopentenyl diphosphate from 1- deoxy-D-xylulose 5-phosphate: step 4/6.
Sequence Caution Sequence=AAF24570.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the IspF family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast stroma {ECO:0000305|PubMed:18236010}.
Subunit Homotrimer. {ECO:0000269|PubMed:17660251}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009669 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30696936 RefSeq NP_850971 231 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
22330411 RefSeq NP_564819 223 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Identical Sequences to LMP009669 proteins

Reference Database Accession Length Protein Name
GI:30696936 GenBank AAG52445.1 231 unknown protein; 376-1789 [Arabidopsis thaliana]
GI:30696936 GenBank AAK43969.1 231 unknown protein [Arabidopsis thaliana]
GI:30696936 GenBank AAL15202.1 231 unknown protein [Arabidopsis thaliana]
GI:30696936 GenBank AEE34174.1 231 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:22330411 GenBank AEE34175.1 223 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:22330411 GenBank AFX58104.1 223 Sequence 20 from patent US 8309323
GI:30696936 SwissProt Q9CAK8.1 231 RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic; Short=MECDP-synthase; Short=MECPS; Short=MECS; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009669 proteins

Reference Database Accession Length Protein Name
GI:30696936 GenBank AAG35071.1 223 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (chloroplast) [Arabidopsis thaliana]
GI:22330411 GenBank AAG35071.1 223 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (chloroplast) [Arabidopsis thaliana]
GI:22330411 GenBank AAK43969.1 231 unknown protein [Arabidopsis thaliana]
GI:22330411 GenBank AAL15202.1 231 unknown protein [Arabidopsis thaliana]
GI:30696936 GenBank AAM62786.1 231 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:22330411 GenBank AEE34174.1 231 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:30696936 GenBank AEE34175.1 223 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:30696936 GenBank AFX58104.1 223 Sequence 20 from patent US 8309323
GI:30696936 RefSeq NP_564819.2 223 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:22330411 RefSeq NP_850971.1 231 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana]
GI:30696936 RefSeq XP_010418436.1 229 PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic [Camelina sativa]
GI:22330411 SwissProt Q9CAK8.1 231 RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic; Short=MECDP-synthase; Short=MECPS; Short=MECS; Flags: Precursor [Arabidopsis thaliana]