Gene/Proteome Database (LMPD)

LMPD ID
LMP009668
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
24-methylenesterol C-methyltransferase 3
Gene Symbol
Synonyms
sterol methyltransferase 3
Alternate Names
24-methylenesterol C-methyltransferase 3
Chromosome
1
EC Number
2.1.1.143
Summary
Encodes S-adenosyl-methionine-sterol-C-methyltransferase, an enzyme in the sterol biosynthetic pathway.
Orthologs

Proteins

24-methylenesterol C-methyltransferase 3
Refseq ID NP_177736
Protein GI 15222955
UniProt ID Q94JS4
mRNA ID NM_106258
Length 359
RefSeq Status REVIEWED
MDSVALYCTAGLIAGAVYWFICVLGPAERKGKRASDLSGGSISAEKVKDNYNQYWSFFRKPKEIESAEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPHVPGKSDKDATRIHEEMAVDLIKVKPGQKILDAGCGVGGPMRAIAAHSKAQVTGITINEYQVQRAKLHNKKAGLDSLCNVVCGNFLKMPFDENTFDGAYSIEATCHAPKLEEVYSEIFRVMKPGSLFVSYEWVTTEKYRDDDEEHKDVIQGIERGDALPGLRSYADIAVTAKKVGFEVVKEKDLAKPPSKPWWNRLKMGRIAYWRNHVVVVILSAIGVAPKGTVDVHKMLFKTADYLTRGGETGIFSPMHMILCRKPEKASE

Gene Information

Entrez Gene ID
Gene Name
24-methylenesterol C-methyltransferase 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0030797 IEA:UniProtKB-EC F 24-methylenesterol C-methyltransferase activity
GO:0003838 TAS:TAIR F sterol 24-C-methyltransferase activity
GO:0016126 TAS:TAIR P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath00100 Steroid biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-2541 plant sterol biosynthesis
PWY-2541 plant sterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR013216 Methyltransferase type 11
IPR029063 S-adenosyl-L-methionine-dependent methyltransferase
IPR013705 Sterol methyltransferase C-terminal

UniProt Annotations

Entry Information

Gene Name
24-methylenesterol C-methyltransferase 3
Protein Entry
SMT3B_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity S-adenosyl-L-methionine + 24-methylenelophenol = S-adenosyl-L-homocysteine + (Z)-24-ethylidenelophenol.
Function Catalyzes the methyl transfer from S-adenosyl-methionine to the methylene group of 24-methylene lophenol to form 24- ethylidene lophenol.
Pathway Steroid biosynthesis; sterol biosynthesis.
Similarity Belongs to the class I-like SAM-binding methyltransferase superfamily. Erg6/SMT family. {ECO:0000255|PROSITE-ProRule:PRU01022}.
Subcellular Location Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009668 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15222955 RefSeq NP_177736 359 24-methylenesterol C-methyltransferase 3

Identical Sequences to LMP009668 proteins

Reference Database Accession Length Protein Name
GI:15222955 GenBank ACW85315.1 359 Sequence 1230 from patent US 7569389
GI:15222955 GenBank ACW88686.1 359 Sequence 5841 from patent US 7569389
GI:15222955 GenBank ACW98727.1 359 Sequence 19475 from patent US 7569389
GI:15222955 GenBank ACW99992.1 359 Sequence 21201 from patent US 7569389
GI:15222955 GenBank AEE35795.1 359 24-methylenesterol C-methyltransferase 3 [Arabidopsis thaliana]
GI:15222955 SwissProt Q94JS4.1 359 RecName: Full=24-methylenesterol C-methyltransferase 3; Short=24-sterol C-methyltransferase 3; Short=Sterol-C-methyltransferase 3 [Arabidopsis thaliana]

Related Sequences to LMP009668 proteins

Reference Database Accession Length Protein Name
GI:15222955 GenBank AAB62809.1 359 S-adenosyl-methionine-sterol-C-methyltransferase [Arabidopsis thaliana]
GI:15222955 GenBank ACW89255.1 359 Sequence 6611 from patent US 7569389
GI:15222955 GenBank ACW97325.1 359 Sequence 17559 from patent US 7569389
GI:15222955 GenBank ACX05529.1 359 Sequence 28748 from patent US 7569389
GI:15222955 GenBank EFH65316.1 359 S-adenosyl-methionine-sterol-C-methyltransferase 3 [Arabidopsis lyrata subsp. lyrata]
GI:15222955 RefSeq XP_002889057.1 359 S-adenosyl-methionine-sterol-C-methyltransferase 3 [Arabidopsis lyrata subsp. lyrata]