Gene/Proteome Database (LMPD)
LMPD ID
LMP009668
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
24-methylenesterol C-methyltransferase 3
Gene Symbol
Synonyms
sterol methyltransferase 3
Alternate Names
24-methylenesterol C-methyltransferase 3
Chromosome
1
EC Number
2.1.1.143
Summary
Encodes S-adenosyl-methionine-sterol-C-methyltransferase, an enzyme in the sterol biosynthetic pathway.
Orthologs
Proteins
| 24-methylenesterol C-methyltransferase 3 | |
|---|---|
| Refseq ID | NP_177736 |
| Protein GI | 15222955 |
| UniProt ID | Q94JS4 |
| mRNA ID | NM_106258 |
| Length | 359 |
| RefSeq Status | REVIEWED |
| MDSVALYCTAGLIAGAVYWFICVLGPAERKGKRASDLSGGSISAEKVKDNYNQYWSFFRKPKEIESAEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPHVPGKSDKDATRIHEEMAVDLIKVKPGQKILDAGCGVGGPMRAIAAHSKAQVTGITINEYQVQRAKLHNKKAGLDSLCNVVCGNFLKMPFDENTFDGAYSIEATCHAPKLEEVYSEIFRVMKPGSLFVSYEWVTTEKYRDDDEEHKDVIQGIERGDALPGLRSYADIAVTAKKVGFEVVKEKDLAKPPSKPWWNRLKMGRIAYWRNHVVVVILSAIGVAPKGTVDVHKMLFKTADYLTRGGETGIFSPMHMILCRKPEKASE | |
Gene Information
Entrez Gene ID
Gene Name
24-methylenesterol C-methyltransferase 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0030797 | IEA:UniProtKB-EC | F | 24-methylenesterol C-methyltransferase activity |
| GO:0003838 | TAS:TAIR | F | sterol 24-C-methyltransferase activity |
| GO:0016126 | TAS:TAIR | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath00100 | Steroid biosynthesis |
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
24-methylenesterol C-methyltransferase 3
Protein Entry
SMT3B_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | S-adenosyl-L-methionine + 24-methylenelophenol = S-adenosyl-L-homocysteine + (Z)-24-ethylidenelophenol. |
| Function | Catalyzes the methyl transfer from S-adenosyl-methionine to the methylene group of 24-methylene lophenol to form 24- ethylidene lophenol. |
| Pathway | Steroid biosynthesis; sterol biosynthesis. |
| Similarity | Belongs to the class I-like SAM-binding methyltransferase superfamily. Erg6/SMT family. {ECO:0000255|PROSITE-ProRule:PRU01022}. |
| Subcellular Location | Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009668 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15222955 | RefSeq | NP_177736 | 359 | 24-methylenesterol C-methyltransferase 3 |
Identical Sequences to LMP009668 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15222955 | GenBank | ACW85315.1 | 359 | Sequence 1230 from patent US 7569389 |
| GI:15222955 | GenBank | ACW88686.1 | 359 | Sequence 5841 from patent US 7569389 |
| GI:15222955 | GenBank | ACW98727.1 | 359 | Sequence 19475 from patent US 7569389 |
| GI:15222955 | GenBank | ACW99992.1 | 359 | Sequence 21201 from patent US 7569389 |
| GI:15222955 | GenBank | AEE35795.1 | 359 | 24-methylenesterol C-methyltransferase 3 [Arabidopsis thaliana] |
| GI:15222955 | SwissProt | Q94JS4.1 | 359 | RecName: Full=24-methylenesterol C-methyltransferase 3; Short=24-sterol C-methyltransferase 3; Short=Sterol-C-methyltransferase 3 [Arabidopsis thaliana] |
Related Sequences to LMP009668 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15222955 | GenBank | AAB62809.1 | 359 | S-adenosyl-methionine-sterol-C-methyltransferase [Arabidopsis thaliana] |
| GI:15222955 | GenBank | ACW89255.1 | 359 | Sequence 6611 from patent US 7569389 |
| GI:15222955 | GenBank | ACW97325.1 | 359 | Sequence 17559 from patent US 7569389 |
| GI:15222955 | GenBank | ACX05529.1 | 359 | Sequence 28748 from patent US 7569389 |
| GI:15222955 | GenBank | EFH65316.1 | 359 | S-adenosyl-methionine-sterol-C-methyltransferase 3 [Arabidopsis lyrata subsp. lyrata] |
| GI:15222955 | RefSeq | XP_002889057.1 | 359 | S-adenosyl-methionine-sterol-C-methyltransferase 3 [Arabidopsis lyrata subsp. lyrata] |