Gene/Proteome Database (LMPD)

LMPD ID
LMP009155
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
CG9804 gene product from transcript CG9804-RA
Gene Symbol
Synonyms
Dmel\CG9804
Alternate Names
CG9804; CG9804-PA
Chromosome
3R
Map Location
82B1-82B1
EC Number
2.3.1.181

Proteins

CG9804
Refseq ID NP_649472
Protein GI 21355483
UniProt ID Q9VN27
mRNA ID NM_141215
Length 234
RefSeq Status REVIEWED
MPFVRPLVTVVRAGRHSYSAGLQLQQRLARSNQILNPPAEFRNYLVLQEHDPVYTVGLRTKDYTAQDEDRLRRLGADFHRTDRGGLITFHGPGQLVAYPILHLGQFVPSIRWYVATLERMVVEACHQMGISSAKATKDTGIWVGDNKICAIGIHGSRYVTTHGIGLNCCTDLQWFEHIVPCGIEGKGVTSLSKELDRHFPVEEASGALLNSFAKVFECRLQEHAKKPASSAEIG

Gene Information

Entrez Gene ID
Gene Name
CG9804 gene product from transcript CG9804-RA
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0016874 IEA:UniProtKB-KW F ligase activity
GO:0033819 ISS:UniProtKB F lipoyl(octanoyl) transferase activity
GO:0016415 IEA:InterPro F octanoyltransferase activity
GO:0009107 IEA:InterPro P lipoate biosynthetic process
GO:0009249 ISS:UniProtKB P protein lipoylation

KEGG Pathway Links

KEGG Pathway ID Description
dme00785 Lipoic acid metabolism
ko00785 Lipoic acid metabolism
dme01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR004143 Biotin/lipoate A/B protein ligase
IPR000544 Octanoyltransferase
IPR020605 Octanoyltransferase, conserved site

UniProt Annotations

Entry Information

Gene Name
CG9804 gene product from transcript CG9804-RA
Protein Entry
LIPT2_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Catalytic Activity Octanoyl-[acyl-carrier-protein] + protein = protein N(6)-(octanoyl)lysine + [acyl-carrier-protein].
Function Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity). {ECO:0000250}.
Miscellaneous In the reaction, the free carboxyl group of octanoic acid is attached via an amide linkage to the epsilon- amino group of a specific lysine residue of lipoyl domains of lipoate-dependent enzymes. {ECO:0000250}.
Pathway Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 1/2.
Similarity Belongs to the LipB family. {ECO:0000305}.
Similarity Contains 1 BPL/LPL catalytic domain. {ECO:0000255|PROSITE-ProRule:PRU01067}.
Subcellular Location Mitochondrion {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009155 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21355483 RefSeq NP_649472 234 CG9804

Identical Sequences to LMP009155 proteins

Reference Database Accession Length Protein Name
GI:21355483 GenBank AAM11028.1 234 GH04831p [Drosophila melanogaster]
GI:21355483 GenBank ACL84612.1 234 CG9804-PA, partial [synthetic construct]
GI:21355483 GenBank ACL89510.1 234 CG9804-PA [synthetic construct]
GI:21355483 gnl FlyBase 234 CG9804 [Drosophila melanogaster]
GI:21355483 SwissProt Q9VN27.1 234 RecName: Full=Putative lipoyltransferase 2, mitochondrial; AltName: Full=Lipoate-protein ligase B; AltName: Full=Lipoyl/octanoyl transferase; AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase; Flags: Precursor [Drosophila melanogaster]

Related Sequences to LMP009155 proteins

Reference Database Accession Length Protein Name
GI:21355483 GenBank EDV47786.1 234 GG11554 [Drosophila erecta]
GI:21355483 GenBank EDW95664.1 234 GE25349 [Drosophila yakuba]
GI:21355483 GenBank EDX11609.1 234 GD19677 [Drosophila simulans]
GI:21355483 RefSeq XP_001978828.1 234 GG11554 [Drosophila erecta]
GI:21355483 RefSeq XP_002095952.1 234 GE25349 [Drosophila yakuba]
GI:21355483 RefSeq XP_002102106.1 234 GD19677 [Drosophila simulans]