Gene/Proteome Database (LMPD)
Proteins
| CG4406 | |
|---|---|
| Refseq ID | NP_569968 |
| Protein GI | 24639234 |
| UniProt ID | Q8T4E1 |
| mRNA ID | NM_130612 |
| Length | 355 |
| RefSeq Status | REVIEWED |
| MFNIMLVKFVVIFALILASCRVEADNTSVLPEGFVDAAQRSTHTNNWAVLVDASRFWFNYRHVANVLSIYRSVKRLGIPDSQIILMIADDMACNARNPRPGQVYNNANQHINVYGDDVEVDYRGYEVTVENFVRLLTGRTQNGTARSKKLLSDAGSNVLIYLTGHGGDGFLKFQDSEEITSQELADGIQQMWEKKRYNELFFMVDTCQAASLYEKFTSPNVLAVASSLVGEDSLSHHVDPSIGVYMIDRYTYYALEFLEKVQPFSKRTIGEFLQVCPKRVCISTVGVRKDLYPRDPHKVPITDFFGAIRPTRVSTDRINVTLANEDDFIFDKDKMVTKKPFKIVMESQFPSELFK | |
Gene Information
Entrez Gene ID
Gene Name
CG4406 gene product from transcript CG4406-RA
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042765 | ISS:UniProtKB | C | GPI-anchor transamidase complex |
| GO:0003923 | ISS:UniProtKB | F | GPI-anchor transamidase activity |
| GO:0004197 | IEA:InterPro | F | cysteine-type endopeptidase activity |
| GO:0016255 | IEA:InterPro | P | attachment of GPI anchor to protein |
Domain Information
UniProt Annotations
Entry Information
Gene Name
CG4406 gene product from transcript CG4406-RA
Protein Entry
Q8T4E1_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Function | Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein (By similarity). |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Sequence Caution | Sequence=CAA15687.1; Type=Erroneous gene model prediction; Evidence= ; |
| Similarity | Belongs to the peptidase C13 family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009153 (as displayed in Record Overview)
Identical Sequences to LMP009153 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24639234 | GenBank | AAL89972.1 | 355 | AT02512p [Drosophila melanogaster] |
| GI:24639234 | GenBank | ACL87299.1 | 355 | CG4406-PA, partial [synthetic construct] |
| GI:24639234 | gnl | FlyBase | 355 | CG4406 [Drosophila melanogaster] |
| GI:24639234 | SwissProt | Q8T4E1.1 | 355 | RecName: Full=Putative GPI-anchor transamidase; Short=GPI transamidase; Flags: Precursor [Drosophila melanogaster] |
Related Sequences to LMP009153 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24639234 | GenBank | EDV45549.1 | 351 | GG12662 [Drosophila erecta] |
| GI:24639234 | GenBank | EDW43906.1 | 355 | GM18930 [Drosophila sechellia] |
| GI:24639234 | GenBank | EDX01437.1 | 351 | GE16991 [Drosophila yakuba] |
| GI:24639234 | RefSeq | XP_001982580.1 | 351 | GG12662 [Drosophila erecta] |
| GI:24639234 | RefSeq | XP_002040435.1 | 355 | GM18930 [Drosophila sechellia] |
| GI:24639234 | RefSeq | XP_002100329.1 | 351 | GE16991 [Drosophila yakuba] |