Gene/Proteome Database (LMPD)

LMPD ID
LMP009093
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
CG2852 gene product from transcript CG2852-RD
Gene Symbol
Synonyms
Dmel\CG2852
Chromosome
2R
Map Location
58F3-58F3

Proteins

CG2852, isoform A
Refseq ID NP_611695
Protein GI 20130249
UniProt ID Q9W227
mRNA ID NM_137851
Length 205
RefSeq Status REVIEWED
MKLFLSVFVVALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAKADATD
CG2852, isoform D
Refseq ID NP_726217
Protein GI 665402854
UniProt ID Q9W227
mRNA ID NM_166539
Length 205
RefSeq Status REVIEWED
Protein sequence is identical to GI:20130249 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
CG2852 gene product from transcript CG2852-RD
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0012505 IDA:FlyBase C endomembrane system
GO:0005576 IDA:FlyBase C extracellular region
GO:0005615 IDA:FlyBase C extracellular space
GO:0005811 IDA:FlyBase C lipid particle
GO:0005875 IDA:FlyBase C microtubule associated complex
GO:0003755 IEA:UniProtKB-KW F peptidyl-prolyl cis-trans isomerase activity
GO:0032504 IEP:FlyBase P multicellular organism reproduction
GO:0006457 IEA:InterPro P protein folding

Domain Information

InterPro Annotations

Accession Description
IPR029000 Cyclophilin-like domain
IPR024936 Cyclophilin-type peptidyl-prolyl cis-trans isomerase
IPR002130 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain
IPR020892 Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site

UniProt Annotations

Entry Information

Gene Name
CG2852 gene product from transcript CG2852-RD
Protein Entry
Q9W227_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Catalytic Activity Peptidylproline (omega=180) = peptidylproline (omega=0). {ECO:0000256|RuleBase:RU000493, ECO:0000256|SAAS:SAAS00020681}.
Function PPIases accelerate the folding of proteins.
Function PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Similarity Belongs to the cyclophilin-type PPIase family.
Similarity Contains 1 PPIase cyclophilin-type domain.
Similarity Contains PPIase cyclophilin-type domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP009093 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20130249 RefSeq NP_611695 205 CG2852, isoform A

Identical Sequences to LMP009093 proteins

Reference Database Accession Length Protein Name
GI:20130249 GenBank AAX33414.1 205 RE50843p [Drosophila melanogaster]
GI:20130249 GenBank ABL47910.1 205 Sequence 249 from patent US 7135558
GI:20130249 GenBank ACL88617.1 205 CG2852-PA, partial [synthetic construct]
GI:20130249 gnl FlyBase 205 CG2852, isoform A [Drosophila melanogaster]
GI:20130249 gnl FlyBase 205 CG2852, isoform D [Drosophila melanogaster]
GI:20130249 RefSeq NP_726217.2 205 CG2852, isoform D [Drosophila melanogaster]

Related Sequences to LMP009093 proteins

Reference Database Accession Length Protein Name
GI:20130249 GenBank EDV54897.1 205 GG21776 [Drosophila erecta]
GI:20130249 GenBank EDW01661.1 205 GH20332 [Drosophila grimshawi]
GI:20130249 GenBank EDW08506.1 205 moj29 [Drosophila mojavensis]
GI:20130249 RefSeq XP_001974497.1 205 GG21776 [Drosophila erecta]
GI:20130249 RefSeq XP_001986794.1 205 GH20332 [Drosophila grimshawi]
GI:20130249 RefSeq XP_002004571.1 205 moj29 [Drosophila mojavensis]