Gene/Proteome Database (LMPD)
Proteins
| CG4956 | |
|---|---|
| Refseq ID | NP_651428 |
| Protein GI | 85815866 |
| UniProt ID | Q9VBM4 |
| mRNA ID | NM_143171 |
| Length | 302 |
| RefSeq Status | REVIEWED |
| MLRFRVLLRSTCGWSRRMCFRAEEGFHRHFQLHRIKVMGLLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTSVDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLDRSYDVGWRRNFDMVLGKRRFWIFFSPTISSPLPTDGTQWFQKQTV | |
Gene Information
Entrez Gene ID
Gene Name
CG4956 gene product from transcript CG4956-RA
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:FlyBase | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG4956 gene product from transcript CG4956-RA
Protein Entry
Q9VBM4_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009088 (as displayed in Record Overview)
Identical Sequences to LMP009088 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:85815866 | GenBank | AAY51541.1 | 302 | IP01459p [Drosophila melanogaster] |
| GI:85815866 | GenBank | ACL84226.1 | 302 | CG4956-PA, partial [synthetic construct] |
| GI:85815866 | GenBank | ACL89209.1 | 302 | CG4956-PA [synthetic construct] |
| GI:85815866 | gnl | FlyBase | 302 | CG4956 [Drosophila melanogaster] |
Related Sequences to LMP009088 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:85815866 | GenBank | EDW45032.1 | 302 | GM10218 [Drosophila sechellia] |
| GI:85815866 | GenBank | EDW98705.1 | 302 | GE10664 [Drosophila yakuba] |
| GI:85815866 | GenBank | EDX14470.1 | 302 | GD18169 [Drosophila simulans] |
| GI:85815866 | RefSeq | XP_002041294.1 | 302 | GM10218 [Drosophila sechellia] |
| GI:85815866 | RefSeq | XP_002098993.1 | 302 | GE10664 [Drosophila yakuba] |
| GI:85815866 | RefSeq | XP_002104967.1 | 302 | GD18169 [Drosophila simulans] |