Gene/Proteome Database (LMPD)
Proteins
| CG17197 | |
|---|---|
| Refseq ID | NP_651425 |
| Protein GI | 221459571 |
| UniProt ID | Q9VBM7 |
| mRNA ID | NM_143168 |
| Length | 290 |
| RefSeq Status | REVIEWED |
| MCLIWACTKYLARRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKIKRVQHHSPKLQFLRVSD | |
Gene Information
Entrez Gene ID
Gene Name
CG17197 gene product from transcript CG17197-RB
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:FlyBase | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG17197 gene product from transcript CG17197-RB
Protein Entry
Q9VBM7_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009085 (as displayed in Record Overview)
Identical Sequences to LMP009085 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:221459571 | GenBank | AAY51575.1 | 290 | IP01230p [Drosophila melanogaster] |
| GI:221459571 | GenBank | ACL84243.1 | 290 | CG17197-PB, partial [synthetic construct] |
| GI:221459571 | GenBank | ACL89196.1 | 290 | CG17197-PB [synthetic construct] |
| GI:221459571 | gnl | FlyBase | 290 | CG17197 [Drosophila melanogaster] |
Related Sequences to LMP009085 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:221459571 | GenBank | EDV53626.1 | 281 | GG12221 [Drosophila erecta] |
| GI:221459571 | GenBank | EDW45029.1 | 288 | GM10221 [Drosophila sechellia] |
| GI:221459571 | GenBank | EDW98708.1 | 276 | GE10668 [Drosophila yakuba] |
| GI:221459571 | RefSeq | XP_001981756.1 | 281 | GG12221 [Drosophila erecta] |
| GI:221459571 | RefSeq | XP_002041291.1 | 288 | GM10221 [Drosophila sechellia] |
| GI:221459571 | RefSeq | XP_002098996.1 | 276 | GE10668 [Drosophila yakuba] |