Gene/Proteome Database (LMPD)
Proteins
| DNZDHHC/NEW1 zinc finger protein 11 | |
|---|---|
| Refseq ID | NP_477449 |
| Protein GI | 17137702 |
| UniProt ID | Q9VKN8 |
| mRNA ID | NM_058101 |
| Length | 276 |
| RefSeq Status | REVIEWED |
| MVFIRDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLPCTSLNHASRYHDTPLLSHEV | |
Gene Information
Entrez Gene ID
Gene Name
DNZDHHC/NEW1 zinc finger protein 11
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:FlyBase | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0046331 | IMP:FlyBase | P | lateral inhibition |
| GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
DNZDHHC/NEW1 zinc finger protein 11
Protein Entry
Q9VKN8_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009076 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17137702 | RefSeq | NP_477449 | 276 | DNZDHHC/NEW1 zinc finger protein 11 |
Identical Sequences to LMP009076 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17137702 | GenBank | EDX04620.1 | 276 | GD22217 [Drosophila simulans] |
| GI:17137702 | GenBank | ACL83760.1 | 276 | Dnz1-PA, partial [synthetic construct] |
| GI:17137702 | GenBank | ACL88872.1 | 276 | Dnz1-PA [synthetic construct] |
| GI:17137702 | RefSeq | XP_002036593.1 | 276 | GM11347 [Drosophila sechellia] |
| GI:17137702 | RefSeq | XP_002088294.1 | 276 | GE13229 [Drosophila yakuba] |
| GI:17137702 | RefSeq | XP_002079035.1 | 276 | GD22217 [Drosophila simulans] |
Related Sequences to LMP009076 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17137702 | GenBank | ABY55426.1 | 273 | Dnz1 [Drosophila mauritiana] |
| GI:17137702 | GenBank | ABY55427.1 | 273 | Dnz1 [Drosophila mauritiana] |
| GI:17137702 | GenBank | ABY55428.1 | 273 | Dnz1 [Drosophila mauritiana] |
| GI:17137702 | GenBank | ACD56241.1 | 273 | DNZ1 [Drosophila simulans] |
| GI:17137702 | GenBank | EDV58964.1 | 276 | GG10348 [Drosophila erecta] |
| GI:17137702 | RefSeq | XP_001969905.1 | 276 | GG10348 [Drosophila erecta] |