Gene/Proteome Database (LMPD)
Proteins
| Niemann-Pick type C-2h, isoform A | |
|---|---|
| Refseq ID | NP_651824 |
| Protein GI | 21358239 |
| UniProt ID | Q9VA41 |
| mRNA ID | NM_143567 |
| Length | 157 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:386766791 (mRNA isoform) | |
| Niemann-Pick type C-2h, isoform B | |
|---|---|
| Refseq ID | NP_733400 |
| Protein GI | 24651500 |
| UniProt ID | Q8IMH5 |
| mRNA ID | NM_170521 |
| Length | 130 |
| RefSeq Status | REVIEWED |
| MLRLSSLLPVAFALVLSSVSAEIVNFQTCEDSVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTLVASLGWAKSENVELPLLTMDQEACNPYTIRWALKDPVSQKRCCFTIDIKVVR | |
| Niemann-Pick type C-2h, isoform C | |
|---|---|
| Refseq ID | NP_001247376 |
| Protein GI | 386766791 |
| UniProt ID | Q9VA41 |
| mRNA ID | NM_001260447 |
| Length | 157 |
| RefSeq Status | REVIEWED |
| MLRLSSLLPVAFALVLSSVSAEIVNFQTCEDSVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTLVASLGWAKSENVELPLLTMDQEACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWALKDPVSQKRCCFTIDIKVVR | |
Gene Information
Entrez Gene ID
Gene Name
Niemann-Pick type C-2h
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IDA:FlyBase | C | extracellular region |
| GO:0005615 | IDA:FlyBase | C | extracellular space |
| GO:0030882 | IDA:FlyBase | F | lipid antigen binding |
| GO:0001530 | IDA:FlyBase | F | lipopolysaccharide binding |
| GO:0070891 | IDA:FlyBase | F | lipoteichoic acid binding |
| GO:0042834 | IDA:FlyBase | F | peptidoglycan binding |
| GO:0042381 | IEP:FlyBase | P | hemolymph coagulation |
| GO:0015918 | ISS:FlyBase | P | sterol transport |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP009059 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 24651500 | RefSeq | NP_733400 | 130 | Niemann-Pick type C-2h, isoform B |
| 386766791 | RefSeq | NP_001247376 | 157 | Niemann-Pick type C-2h, isoform C |
Identical Sequences to LMP009059 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386766791 | GenBank | AAL49296.1 | 157 | RH04252p [Drosophila melanogaster] |
| GI:386766791 | GenBank | ACL87177.1 | 157 | CG11315-PA, partial [synthetic construct] |
| GI:386766791 | GenBank | ACL91707.1 | 157 | CG11315-PA [synthetic construct] |
| GI:386766791 | gnl | FlyBase | 157 | Niemann-Pick type C-2h, isoform A [Drosophila melanogaster] |
| GI:24651500 | gnl | FlyBase | 130 | Niemann-Pick type C-2h, isoform B [Drosophila melanogaster] |
| GI:386766791 | gnl | FlyBase | 157 | Niemann-Pick type C-2h, isoform C [Drosophila melanogaster] |
| GI:386766791 | RefSeq | NP_651824.1 | 157 | Niemann-Pick type C-2h, isoform A [Drosophila melanogaster] |
Related Sequences to LMP009059 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386766791 | GenBank | EDV53026.1 | 161 | GG11913 [Drosophila erecta] |
| GI:24651500 | GenBank | EDW53560.1 | 130 | GM12130 [Drosophila sechellia] |
| GI:386766791 | GenBank | EDX15052.1 | 159 | GD16847 [Drosophila simulans] |
| GI:24651500 | GenBank | EDX15053.1 | 130 | GD16836 [Drosophila simulans] |
| GI:386766791 | GenBank | ACL87778.1 | 159 | CG11314-PA, partial [synthetic construct] |
| GI:24651500 | GenBank | ACL91707.1 | 157 | CG11315-PA [synthetic construct] |
| GI:386766791 | gnl | FlyBase | 159 | Niemann-Pick type C-2g, isoform B [Drosophila melanogaster] |
| GI:24651500 | gnl | FlyBase | 157 | Niemann-Pick type C-2h, isoform C [Drosophila melanogaster] |
| GI:386766791 | RefSeq | XP_001981156.1 | 161 | GG11913 [Drosophila erecta] |
| GI:24651500 | RefSeq | XP_002037401.1 | 130 | GM12130 [Drosophila sechellia] |
| GI:386766791 | RefSeq | XP_002105549.1 | 159 | GD16847 [Drosophila simulans] |
| GI:24651500 | RefSeq | XP_002105550.1 | 130 | GD16836 [Drosophila simulans] |