Gene/Proteome Database (LMPD)

LMPD ID
LMP009043
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
zucchini
Gene Symbol
Synonyms
CG12314; Dmel\CG12314; Zuc; ZUC
Alternate Names
CG12314-PA; zuc-PA; zucchini
Chromosome
2L
Map Location
33B5-33F2
EC Number
3.1.4.-

Proteins

zucchini
Refseq ID NP_609530
Protein GI 20129461
UniProt ID Q9VKD7
mRNA ID NM_135686
Length 253
RefSeq Status REVIEWED
MLITQIIMKQIRDYPIVSTISIAVSTVLASEVIWKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGSQIQLK

Gene Information

Entrez Gene ID
Gene Name
zucchini
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043186 IDA:FlyBase C P granule
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005741 IEA:UniProtKB-KW C mitochondrial outer membrane
GO:0005739 IDA:UniProtKB C mitochondrion
GO:0035755 IDA:UniProtKB F cardiolipin hydrolase activity
GO:0046843 IMP:FlyBase P dorsal appendage formation
GO:0031047 IMP:FlyBase P gene silencing by RNA
GO:0030717 IMP:FlyBase P karyosome formation
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0007126 IEA:UniProtKB-KW P meiotic nuclear division
GO:0048477 IMP:FlyBase P oogenesis
GO:0034587 IMP:UniProtKB P piRNA metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
6226058 Glycerophospholipid biosynthesis
6225965 Metabolism of lipids and lipoproteins
6226059 Phospholipid metabolism
6226882 Synthesis of PG

Domain Information

InterPro Annotations

Accession Description
IPR025202 Phospholipase D-like domain

UniProt Annotations

Entry Information

Gene Name
zucchini
Protein Entry
ZUC_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Disruption Phenotype Defects in mid oogenesis. Females are viable but produce eggs with a range of dorso-ventral patterning defects. Flies lay few eggs, all of which are completely ventralized and often collapsed. Effects are due to defects in piRNA biogenesis and derepression of retrotransposons. Defects are not only present in germ cells but also in somatic cells of the ovary. {ECO:0000269|PubMed:17543859}.
Domain In contrast to other members of the phospholipase D family, contains only one PLD phosphodiesterase domain, suggesting that it has a single half-catalytic and requires homodimerization to form a complete active site. {ECO:0000250}.
Function Cardiolipin hydrolase present at the mitochondrial outer membrane required for piRNA metabolic process. Acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting the piRNA metabolic process. Plays a key role in primary biogenesis of piRNAs and is required during oogenesis to repress transposable elements and prevent their mobilization. piRNAs mediate the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Involved in trans-silencing effect (TSE), a homology-dependent repression mechanism by which a P- transgene inserted in subtelomeric heterochromatin via its role in piRNA biogenesis. {ECO:0000269|PubMed:17543859, ECO:0000269|PubMed:19812547, ECO:0000269|PubMed:20559422, ECO:0000269|PubMed:20818334, ECO:0000269|PubMed:20966047, ECO:0000269|PubMed:20966049, ECO:0000269|PubMed:21397848}.
Similarity Belongs to the phospholipase D family. MitoPLD/Zucchini subfamily. {ECO:0000305}.
Similarity Contains 1 PLD phosphodiesterase domain. {ECO:0000305}.
Subcellular Location Mitochondrion outer membrane {ECO:0000269|PubMed:20966047, ECO:0000269|PubMed:21397848}; Single-pass membrane protein {ECO:0000269|PubMed:20966047, ECO:0000269|PubMed:21397848}. Note=Was initially reported to localize to the meiotic nuage, also named P granule (PubMed:17543859). However, it was later shown that the EGFP tag at N-terminus used in initial experiments interfered with mitochondrial localization (PubMed:21397848 and PubMed:20966047). {ECO:0000269|PubMed:17543859}.
Subunit Homodimer. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009043 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20129461 RefSeq NP_609530 253 zucchini

Identical Sequences to LMP009043 proteins

Reference Database Accession Length Protein Name
GI:20129461 EMBL CAR93432.1 253 CG12314-PA [Drosophila melanogaster]
GI:20129461 GenBank AAM49862.1 253 LD05365p [Drosophila melanogaster]
GI:20129461 gnl FlyBase 253 zucchini [Drosophila melanogaster]
GI:20129461 SwissProt Q9VKD7.1 253 RecName: Full=Mitochondrial cardiolipin hydrolase; AltName: Full=Mitochondrial phospholipase homolog; Short=MitoPLD; AltName: Full=Protein zucchini [Drosophila melanogaster]

Related Sequences to LMP009043 proteins

Reference Database Accession Length Protein Name
GI:20129461 EMBL CAL26373.1 253 CG12314 [Drosophila melanogaster]
GI:20129461 GenBank AGA18786.1 253 zucchini [Drosophila melanogaster]
GI:20129461 GenBank AGA18787.1 253 zucchini [Drosophila melanogaster]
GI:20129461 GenBank AGA18789.1 253 zucchini [Drosophila melanogaster]
GI:20129461 GenBank AGA18790.1 253 zucchini [Drosophila melanogaster]
GI:20129461 GenBank AGA18791.1 253 zucchini [Drosophila melanogaster]