Gene/Proteome Database (LMPD)
LMPD ID
LMP009004
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
VAMP-associated protein of 33kDa ortholog A
Gene Symbol
Synonyms
anon-EST:Liang-2.42; anon-WO03040301.124; BcDNA:GM03307; CG5014; clone 2.42; Dmel\CG5014; dVAP; DVAP; DVAP-33A; dvap33a; dVAP33A; DVAP33A; l(1)G0231; VAP; VAP-33; Vap-33-1; VAP-33-1; vap-33A; vap33-1; Vap33-1; VAP33-A; VAPB
Chromosome
X
Map Location
3F9-3F9
Proteins
| VAMP-associated protein of 33kDa ortholog A, isoform A | |
|---|---|
| Refseq ID | NP_996348 |
| Protein GI | 45554154 |
| UniProt ID | Q7KVX5 |
| mRNA ID | NM_206625 |
| Length | 235 |
| RefSeq Status | REVIEWED |
| MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEIKALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPVFYIAVAIAAAIVSLLLGKFFL | |
| VAMP-associated protein of 33kDa ortholog A, isoform B | |
|---|---|
| Refseq ID | NP_570087 |
| Protein GI | 18543325 |
| UniProt ID | Q9W4N8 |
| mRNA ID | NM_130731 |
| Length | 269 |
| RefSeq Status | REVIEWED |
| MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENTSGGGAVGGGTGAAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEIKALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPVFYIAVAIAAAIVSLLLGKFFL | |
Gene Information
Entrez Gene ID
Gene Name
VAMP-associated protein of 33kDa ortholog A
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0012505 | IDA:FlyBase | C | endomembrane system |
| GO:0005783 | IDA:FlyBase | C | endoplasmic reticulum |
| GO:0005615 | IDA:FlyBase | C | extracellular space |
| GO:0005811 | IDA:FlyBase | C | lipid particle |
| GO:0005886 | IDA:FlyBase | C | plasma membrane |
| GO:0008021 | NAS:FlyBase | C | synaptic vesicle |
| GO:0005198 | IEA:InterPro | F | structural molecule activity |
| GO:0008088 | IMP:FlyBase | P | axon cargo transport |
| GO:0031122 | IMP:FlyBase | P | cytoplasmic microtubule organization |
| GO:0050829 | IMP:FlyBase | P | defense response to Gram-negative bacterium |
| GO:0007528 | IMP:FlyBase | P | neuromuscular junction development |
| GO:0007269 | NAS:FlyBase | P | neurotransmitter secretion |
| GO:0046488 | IMP:FlyBase | P | phosphatidylinositol metabolic process |
| GO:0060074 | IMP:FlyBase | P | synapse maturation |
| GO:0016082 | NAS:FlyBase | P | synaptic vesicle priming |
Domain Information
UniProt Annotations
Entry Information
Gene Name
VAMP-associated protein of 33kDa ortholog A
Protein Entry
Q9W4N8_DROME
UniProt ID
Species
Drosophila
Identical and Related Proteins
Unique RefSeq proteins for LMP009004 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 45554154 | RefSeq | NP_996348 | 235 | VAMP-associated protein of 33kDa ortholog A, isoform A |
| 18543325 | RefSeq | NP_570087 | 269 | VAMP-associated protein of 33kDa ortholog A, isoform B |
Identical Sequences to LMP009004 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18543325 | GenBank | ACL85506.1 | 269 | Vap-33-1-PB, partial [synthetic construct] |
| GI:18543325 | GenBank | ACL90354.1 | 269 | Vap-33-1-PB [synthetic construct] |
| GI:18543325 | gnl | FlyBase | 269 | VAMP-associated protein of 33kDa ortholog A, isoform C [Drosophila melanogaster] |
| GI:45554154 | gnl | FlyBase | 235 | VAMP-associated protein of 33kDa ortholog A, isoform A [Drosophila melanogaster] |
| GI:18543325 | gnl | FlyBase | 269 | VAMP-associated protein of 33kDa ortholog A, isoform E [Drosophila melanogaster] |
| GI:18543325 | RefSeq | NP_996347.1 | 269 | VAMP-associated protein of 33kDa ortholog A, isoform C [Drosophila melanogaster] |
| GI:18543325 | RefSeq | NP_996346.2 | 269 | VAMP-associated protein of 33kDa ortholog A, isoform E [Drosophila melanogaster] |
Related Sequences to LMP009004 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45554154 | GenBank | AAL25434.1 | 269 | LD30122p [Drosophila melanogaster] |
| GI:18543325 | GenBank | AAU65102.1 | 295 | Sequence 46047 from patent US 6703491 |
| GI:18543325 | GenBank | EDV45761.1 | 273 | GG18683 [Drosophila erecta] |
| GI:18543325 | GenBank | EDW53217.1 | 251 | GM12317 [Drosophila sechellia] |
| GI:45554154 | GenBank | ACL90354.1 | 269 | Vap-33-1-PB [synthetic construct] |
| GI:45554154 | gnl | FlyBase | 269 | VAMP-associated protein of 33kDa ortholog A, isoform C [Drosophila melanogaster] |
| GI:45554154 | gnl | FlyBase | 269 | VAMP-associated protein of 33kDa ortholog A, isoform E [Drosophila melanogaster] |
| GI:45554154 | RefSeq | NP_996347.1 | 269 | VAMP-associated protein of 33kDa ortholog A, isoform C [Drosophila melanogaster] |
| GI:18543325 | RefSeq | XP_001976834.1 | 273 | GG18683 [Drosophila erecta] |
| GI:18543325 | RefSeq | XP_002037058.1 | 251 | GM12317 [Drosophila sechellia] |
| GI:18543325 | RefSeq | XP_002100144.1 | 269 | GE16322 [Drosophila yakuba] |
| GI:45554154 | RefSeq | NP_996346.2 | 269 | VAMP-associated protein of 33kDa ortholog A, isoform E [Drosophila melanogaster] |