Gene/Proteome Database (LMPD)

LMPD ID
LMP008995
Gene ID
33981
Species
Drosophila melanogaster (Drosophila)
Gene Name
CG4494 gene product from transcript CG4494-RA
Gene Symbol
smt3
Synonyms
anon-EST:Posey240; CG4494; Dm0342; Dmel\CG4494; Dmsmt3; DmSmt3; DmSUMO-1; dsmt3; dSmt3; l(2)04493; l(2)SH0182; l(2)SH2 0182; Smt3; SMT3; sumo; Sumo; SUMO
Chromosome
2L
Map Location
27C7-27C8

Proteins

smt3
Refseq ID NP_477411
Protein GI 17137634
UniProt ID O97102
mRNA ID NM_058063
Length 90
RefSeq Status REVIEWED
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP

Gene Information

Entrez Gene ID
33981
Gene Name
CG4494 gene product from transcript CG4494-RA
Gene Symbol
smt3
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000940 IDA:FlyBase C condensed chromosome outer kinetochore
GO:0000794 IDA:FlyBase C condensed nuclear chromosome
GO:0000780 IDA:FlyBase C condensed nuclear chromosome, centromeric region
GO:0030496 IDA:FlyBase C midbody
GO:0005730 IDA:FlyBase C nucleolus
GO:0005634 IDA:FlyBase C nucleus
GO:0006464 IGI:FlyBase P cellular protein modification process
GO:0071560 IGI:FlyBase P cellular response to transforming growth factor beta stimulus
GO:0021952 IMP:FlyBase P central nervous system projection neuron axonogenesis
GO:0060997 IMP:FlyBase P dendritic spine morphogenesis
GO:0046843 IMP:FlyBase P dorsal appendage formation
GO:0055088 IMP:FlyBase P lipid homeostasis
GO:0007052 IMP:FlyBase P mitotic spindle organization
GO:0006909 IMP:FlyBase P phagocytosis
GO:0043406 IMP:FlyBase P positive regulation of MAP kinase activity
GO:0046579 IMP:FlyBase P positive regulation of Ras protein signal transduction
GO:0016926 IGI:FlyBase P protein desumoylation
GO:0006606 IGI:FlyBase P protein import into nucleus
GO:0016925 IDA:FlyBase P protein sumoylation
GO:0035073 IMP:FlyBase P pupariation
GO:0035186 IMP:FlyBase P syncytial blastoderm mitotic cell cycle
GO:0006099 IDA:FlyBase P tricarboxylic acid cycle

Domain Information

InterPro Annotations

Accession Description
IPR022617 Rad60/SUMO_like
IPR000626 Ubiquitin-like
IPR029071 Ubiquitin-related domain

UniProt Annotations

Entry Information

Gene Name
CG4494 gene product from transcript CG4494-RA
Protein Entry
O97102_DROME
UniProt ID
O97102
Species
Drosophila

Comments

Comment Type Description
Interaction P09081:bcd; NbExp=3; IntAct=EBI-114439, EBI-196628; P16371:gro; NbExp=2; IntAct=EBI-114439, EBI-153866;
Similarity Belongs to the ubiquitin family. SUMO subfamily.
Similarity Contains 1 ubiquitin-like domain.
Subcellular Location Nucleus .

Identical and Related Proteins

Unique RefSeq proteins for LMP008995 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17137634 RefSeq NP_477411 90 smt3

Identical Sequences to LMP008995 proteins

Reference Database Accession Length Protein Name
GI:17137634 GenBank AAL28638.1 90 LD07775p [Drosophila melanogaster]
GI:17137634 GenBank EDW51942.1 90 GM13677 [Drosophila sechellia]
GI:17137634 GenBank EDX04039.1 90 GD22523 [Drosophila simulans]
GI:17137634 gnl FlyBase 90 smt3 [Drosophila melanogaster]
GI:17137634 RefSeq XP_002036019.1 90 GM13677 [Drosophila sechellia]
GI:17137634 RefSeq XP_002078454.1 90 GD22523 [Drosophila simulans]

Related Sequences to LMP008995 proteins

Reference Database Accession Length Protein Name
GI:17137634 GenBank AAU65277.1 142 Sequence 46222 from patent US 6703491
GI:17137634 GenBank EDV31612.1 91 GF14461 [Drosophila ananassae]
GI:17137634 GenBank EDV59163.1 90 GG23561 [Drosophila erecta]
GI:17137634 GenBank EDW87806.1 90 GE18385 [Drosophila yakuba]
GI:17137634 RefSeq XP_001962391.1 91 GF14461 [Drosophila ananassae]
GI:17137634 RefSeq XP_002088094.1 90 GE18385 [Drosophila yakuba]