Gene/Proteome Database (LMPD)
Proteins
| infertile crescent, isoform A | |
|---|---|
| Refseq ID | NP_476594 |
| Protein GI | 17136246 |
| UniProt ID | Q94515 |
| mRNA ID | NM_057246 |
| Length | 321 |
| RefSeq Status | REVIEWED |
| MGQKVSRTDFEWVYTEEPHASRRKIILEKYPQIKKLFGHDPNFKWVAGAMVLTQILALFVVKDLSWSWLIVAAYCFGGIINHSLMLAVHEISHNLAFGHSRPMHNRILGFICNLPIGLPMSISFKKYHLEHHRYQGDEAIDTDIPTLLEARLFDTTFGKFLWVCLQPFFYIFRPLIINPKPPTRLEIINTVVQLTFNALIVYFLGWKPLAYLLIGSILAMGLHPVAGHFISEHYMFAKGFETYSYYGPLNWITFNVGYHNEHHDFPAVPGSRLPEVKRIAKEFYDTMPQHTSWTRVLYDFIMDPAVGPYARVKRRQRGLAS | |
| infertile crescent, isoform B | |
|---|---|
| Refseq ID | NP_001260118 |
| Protein GI | 442626270 |
| UniProt ID | M9PC47 |
| mRNA ID | NM_001273189 |
| Length | 102 |
| RefSeq Status | REVIEWED |
| MGLHPVAGHFISEHYMFAKGFETYSYYGPLNWITFNVGYHNEHHDFPAVPGSRLPEVKRIAKEFYDTMPQHTSWTRVLYDFIMDPAVGPYARVKRRQRGLAS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016006 | IDA:FlyBase | C | Nebenkern |
| GO:0070938 | IDA:FlyBase | C | contractile ring |
| GO:0005739 | IDA:FlyBase | C | mitochondrion |
| GO:0005886 | ISS:FlyBase | C | plasma membrane |
| GO:0042284 | IDA:FlyBase | F | sphingolipid delta-4 desaturase activity |
| GO:0004768 | IEA:UniProtKB-EC | F | stearoyl-CoA 9-desaturase activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
| GO:0007283 | IMP:FlyBase | P | spermatogenesis |
| GO:0007053 | IMP:FlyBase | P | spindle assembly involved in male meiosis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005804 | Fatty acid desaturase, type 1 |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008978 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17136246 | RefSeq | NP_476594 | 321 | infertile crescent, isoform A |
| 442626270 | RefSeq | NP_001260118 | 102 | infertile crescent, isoform B |
Identical Sequences to LMP008978 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17136246 | EMBL | CAA63889.1 | 321 | Des-1 protein [Drosophila melanogaster] |
| GI:17136246 | GenBank | AAL28744.1 | 321 | LD15458p [Drosophila melanogaster] |
| GI:17136246 | GenBank | AAM12535.1 | 321 | sphingolipid delta 4 desaturase protein DES-1 [Drosophila melanogaster] |
| GI:17136246 | GenBank | ABL48162.1 | 321 | Sequence 1005 from patent US 7135558 |
| GI:17136246 | gnl | FlyBase | 321 | infertile crescent, isoform A [Drosophila melanogaster] |
| GI:442626270 | gnl | FlyBase | 102 | infertile crescent, isoform B [Drosophila melanogaster] |
Related Sequences to LMP008978 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442626270 | EMBL | CAA63889.1 | 321 | Des-1 protein [Drosophila melanogaster] |
| GI:442626270 | GenBank | AAL28744.1 | 321 | LD15458p [Drosophila melanogaster] |
| GI:442626270 | GenBank | AAM12535.1 | 321 | sphingolipid delta 4 desaturase protein DES-1 [Drosophila melanogaster] |
| GI:442626270 | GenBank | ABL48162.1 | 321 | Sequence 1005 from patent US 7135558 |
| GI:17136246 | GenBank | EDV31944.1 | 321 | GF15596 [Drosophila ananassae] |
| GI:17136246 | GenBank | EDW88861.1 | 321 | ifc [Drosophila yakuba] |
| GI:17136246 | GenBank | EDX03887.1 | 321 | GD23376 [Drosophila simulans] |
| GI:442626270 | gnl | FlyBase | 321 | infertile crescent, isoform A [Drosophila melanogaster] |
| GI:442626270 | RefSeq | NP_476594.1 | 321 | infertile crescent, isoform A [Drosophila melanogaster] |
| GI:17136246 | RefSeq | XP_001962723.1 | 321 | GF15596 [Drosophila ananassae] |
| GI:17136246 | RefSeq | XP_002089149.1 | 321 | ifc [Drosophila yakuba] |
| GI:17136246 | RefSeq | XP_002078302.1 | 321 | GD23376 [Drosophila simulans] |