Gene/Proteome Database (LMPD)
Proteins
| Protein DHHC-1 | |
|---|---|
| Refseq ID | NP_510510 |
| Protein GI | 17551530 |
| UniProt ID | O62144 |
| mRNA ID | NM_078109 |
| Length | 295 |
| MQMLYDDGENVDFNKKLQRMMPTQIQDIIATFIFLILLPCGILLHLLYVLPTWYPVMGEAWVIRATCFGVLVFNLYSNWVYMIKTGPNGHHSALPNVIKPGYKHCHSCHSMSPLRAHHCPVCDVCILRRDHHCSFGAVCVGHFNQRYFVAAVINLFIMTLPLVSYSWSLLNIKMTNEIGFGNIWQVVIPHLAWIAGYISIYQFLHVLLFVFTFTVSLFTFYLLTAQVFCIYQGQTRIEFLMDVHAYQLGLLENLHQSLGSRWPFIAISCFIPSPLPTDGLGFVTREMFNLHTKDL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA |
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. {ECO:0000256|RuleBase:RU079119}. |
| Domain | The DHHC domain is required for palmitoyltransferase activity |
| Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000256|RuleBase:RU079119}. |
| Similarity | Belongs to the DHHC palmitoyltransferase family |
| Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000256|RuleBase:RU079119}. |
| Similarity | Contains 1 DHHC-type zinc finger |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000256|RuleBase:RU079119}. |
| Similarity | Contains DHHC-type zinc finger |
| Similarity | Contains DHHC-type zinc finger. {ECO:0000256|SAAS:SAAS00117289}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008736 (as displayed in Record Overview)
Identical Sequences to LMP008736 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP008736 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|