LIPID MAPS

LMPD ID

LMP008312

Gene ID

Species

Caenorhabditis elegans (C. elegans)

Gene Name

Protein LBP-1

Gene Symbol

lbp-1

Synonyms

CELE_F40F4.3

Alternate Names

Protein LBP-1

Chromosome

X

Protein LBP-1
Refseq ID	NP_508557
Protein GI	17568899
UniProt ID	Q20223
mRNA ID	NM_076156
Length	159
RefSeq Status	REVIEWED
MCAKIALLLVLVGAASAAVLPDKFYGTFDLDHSENFDEYLTAKGYGWFTRKLVTFATFKKVFTKTSNKNLFDYSNLTSKKDVHYKNVQLGKAFQGEGLDSTKHEITFTLKDGHLFEHHKPLEGGDAKEETYEYLFDKEFLLVRMSFNGVEGRRFYKRLP

Entrez Gene ID

Gene Name

Protein LBP-1

Gene Symbol

lbp-1

Species

Caenorhabditis elegans

GO ID	Source	Type	Description
GO:0005576	IEA:UniProtKB-KW	C	extracellular region
GO:0008289	IEA:UniProtKB-KW	F	lipid binding
GO:0005215	IEA:InterPro	F	transporter activity

Accession	Description
IPR012674	Calycin
IPR011038	Calycin-like
IPR000463	Cytosolic fatty-acid binding

Gene Name

Protein LBP-1

Protein Entry

FABP1_CAEEL

UniProt ID

Species

C. elegans

Comment Type	Description
Domain	Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000250}.
Function	May play a role in sequestering potentially toxic fatty acids and their peroxidation products, or it may be involved in the maintenance of the impermeable lipid layer of the eggshell. {ECO:0000269\|PubMed:10693745}.
Similarity	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location	Secreted {ECO:0000269\|PubMed:10693745}. Note=From the hypodermis into the perivitelline fluid of the developing embryo prior to hatching.
Tissue Specificity	First detected in hypodermal precursor cells at the time of gastrulation. From the two-fold stage through to three-fold stages, expression is localized exclusively to hyp-7 but disappears in newly hatched L1s and subsequent developmental stages. Expression from L1 to adult stages is found in a single neuron in the ventral cord with a process into the nerve ring. {ECO:0000269\|PubMed:10693745}.

Protein GI	Database	Accession	Length	Protein Name
17568899	RefSeq	NP_508557	159	Protein LBP-1

Reference	Database	Accession	Length	Protein Name
GI:17568899	EMBL	CCD70142.1	159	Protein LBP-1 [Caenorhabditis elegans]
GI:17568899	SwissProt	Q20223.1	159	RecName: Full=Fatty acid-binding protein homolog 1; AltName: Full=Lipid-binding protein 1; Flags: Precursor [Caenorhabditis elegans]

Reference	Database	Accession	Length	Protein Name
GI:17568899	EMBL	CAR99915.1	161	Protein CBG27636 [Caenorhabditis briggsae]
GI:17568899	EMBL	CCD70141.1	161	Protein LBP-2 [Caenorhabditis elegans]
GI:17568899	GenBank	EFO82972.1	166	CRE-LBP-1 protein [Caenorhabditis remanei]
GI:17568899	RefSeq	NP_508558.1	161	Protein LBP-2 [Caenorhabditis elegans]
GI:17568899	RefSeq	XP_003118374.1	166	CRE-LBP-1 protein [Caenorhabditis remanei]
GI:17568899	SwissProt	Q20224.1	161	RecName: Full=Fatty acid-binding protein homolog 2; AltName: Full=Lipid-binding protein 2; Flags: Precursor [Caenorhabditis elegans]