Gene/Proteome Database (LMPD)
Proteins
| Protein CAV-2, isoform a | |
|---|---|
| Refseq ID | NP_001256523 |
| Protein GI | 392921543 |
| UniProt ID | Q18879 |
| mRNA ID | NM_001269594 |
| Length | 351 |
| RefSeq Status | REVIEWED |
| MTRQNTSESDNTQRPPIPQYDTVDDIDELTDAMDKEDHHHHHHHHEHHHQHQGIAQYDTVEEVETLETVHHRTSLNQEVPTPQRRSHPQYDNLDDIDDQEYITEVEVKSNRGSTLTTRPHVTIKQDEIEDIGERQVTVIEIASQKGSTKRVAPRKDYAPSIPLPEHPAQQSAPPTQQSRPQTTSHKPPNPEMEFDIGVKNIAPVLIHKMNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEVWEKHIHHV | |
| Protein CAV-2, isoform b | |
|---|---|
| Refseq ID | NP_001256525 |
| Protein GI | 392921547 |
| UniProt ID | Q18879 |
| mRNA ID | NM_001269596 |
| Length | 319 |
| RefSeq Status | REVIEWED |
| MDKEDHHHHHHHHEHHHQHQGIAQYDTVEEVETLETVHHRTSLNQEVPTPQRRSHPQYDNLDDIDDQEYITEVEVKSNRGSTLTTRPHVTIKQDEIEDIGERQVTVIEIASQKGSTKRVAPRKDYAPSIPLPEHPAQQSAPPTQQSRPQTTSHKPPNPEMEFDIGVKNIAPVLIHKMNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEVWEKHIHHV | |
| Protein CAV-2, isoform c | |
|---|---|
| Refseq ID | NP_001256526 |
| Protein GI | 392921549 |
| UniProt ID | Q18879 |
| mRNA ID | NM_001269597 |
| Length | 160 |
| RefSeq Status | REVIEWED |
| MEFDIGVKNIAPVLIHKMNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEVWEKHIHHV | |
| Protein CAV-2, isoform d | |
|---|---|
| Refseq ID | NP_001256524 |
| Protein GI | 392921545 |
| UniProt ID | Q18879 |
| mRNA ID | NM_001269595 |
| Length | 281 |
| RefSeq Status | REVIEWED |
| MTRQNTSESDNTQRPPIPQYDTVDDIDDQEYITEVEVKSNRGSTLTTRPHVTIKQDEIEDIGERQVTVIEIASQKGSTKRVAPRKDYAPSIPLPEHPAQQSAPPTQQSRPQTTSHKPPNPEMEFDIGVKNIAPVLIHKMNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEVWEKHIHHV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016324 | IDA:UniProtKB | C | apical plasma membrane |
| GO:0005901 | TAS:WormBase | C | caveola |
| GO:0005319 | IMP:UniProtKB | F | lipid transporter activity |
| GO:0004871 | TAS:WormBase | F | signal transducer activity |
| GO:0007166 | TAS:WormBase | P | cell surface receptor signaling pathway |
| GO:0006869 | IMP:GOC | P | lipid transport |
| GO:0007567 | IMP:UniProtKB | P | parturition |
| GO:0046662 | IGI:WormBase | P | regulation of oviposition |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001612 | Caveolin |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=a; IsoId=Q18879-1; Sequence=Displayed; Name=b; IsoId=Q18879-2; Sequence=VSP_043963; Note=No experimental confirmation available.; Name=c; IsoId=Q18879-3; Sequence=VSP_043962; Note=No experimental confirmation available.; Name=d; IsoId=Q18879-4; Sequence=VSP_043964; Note=No experimental confirmation available.; |
| Disruption Phenotype | Defective in the apical uptake of lipid and protein trafficking. Reduced brood size thought to be due to attenuated nutrient supply. {ECO:0000269|PubMed:19158391}. |
| Function | May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can regulate their activity. Thought to have a role in the uptake of lipids and proteins in the intestinal cells; operates in the apical uptake of lipid markers and trafficking of yolk proteins. Affects fecundity and egg laying. {ECO:0000269|PubMed:19158391, ECO:0000269|PubMed:19907693}. |
| Similarity | Belongs to the caveolin family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Cell membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Membrane, caveola {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Apical cell membrane {ECO:0000269|PubMed:19158391}. Note=Potential hairpin-like structure in the membrane. Membrane protein of caveolae (By similarity). {ECO:0000250}. |
| Subunit | Homooligomer. {ECO:0000250}. |
| Tissue Specificity | Expressed in intracellular bodies in intestinal cells. {ECO:0000269|PubMed:19158391}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008289 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 392921543 | RefSeq | NP_001256523 | 351 | Protein CAV-2, isoform a |
| 392921547 | RefSeq | NP_001256525 | 319 | Protein CAV-2, isoform b |
| 392921549 | RefSeq | NP_001256526 | 160 | Protein CAV-2, isoform c |
| 392921545 | RefSeq | NP_001256524 | 281 | Protein CAV-2, isoform d |
Identical Sequences to LMP008289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:392921543 | EMBL | CAB01139.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921547 | EMBL | CBW48350.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921549 | EMBL | CBW48351.1 | 160 | Protein CAV-2, isoform c [Caenorhabditis elegans] |
| GI:392921545 | EMBL | CCD31049.1 | 281 | Protein CAV-2, isoform d [Caenorhabditis elegans] |
| GI:392921543 | SwissProt | Q18879.3 | 351 | RecName: Full=Caveolin-2 [Caenorhabditis elegans] |
Related Sequences to LMP008289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:392921547 | EMBL | CAB01139.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921545 | EMBL | CAB01139.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921549 | EMBL | CAB01139.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921543 | EMBL | CBW48350.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921549 | EMBL | CBW48350.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921545 | EMBL | CBW48350.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921543 | EMBL | CCD31049.1 | 281 | Protein CAV-2, isoform d [Caenorhabditis elegans] |
| GI:392921547 | EMBL | CCD31049.1 | 281 | Protein CAV-2, isoform d [Caenorhabditis elegans] |
| GI:392921543 | GenBank | AAB48299.1 | 351 | caveolin-2 [Caenorhabditis elegans] |
| GI:392921545 | GenBank | AAB48299.1 | 351 | caveolin-2 [Caenorhabditis elegans] |
| GI:392921547 | GenBank | AAB48299.1 | 351 | caveolin-2 [Caenorhabditis elegans] |
| GI:392921549 | GenBank | AAB48299.1 | 351 | caveolin-2 [Caenorhabditis elegans] |
| GI:392921543 | RefSeq | XP_003114363.1 | 282 | CRE-CAV-2 protein [Caenorhabditis remanei] |
| GI:392921547 | RefSeq | NP_001256523.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921549 | RefSeq | NP_001256523.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921545 | RefSeq | NP_001256523.1 | 351 | Protein CAV-2, isoform a [Caenorhabditis elegans] |
| GI:392921543 | RefSeq | NP_001256524.1 | 281 | Protein CAV-2, isoform d [Caenorhabditis elegans] |
| GI:392921547 | RefSeq | NP_001256524.1 | 281 | Protein CAV-2, isoform d [Caenorhabditis elegans] |
| GI:392921543 | RefSeq | NP_001256525.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921549 | RefSeq | NP_001256525.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921545 | RefSeq | NP_001256525.1 | 319 | Protein CAV-2, isoform b [Caenorhabditis elegans] |
| GI:392921549 | SwissProt | Q18879.3 | 351 | RecName: Full=Caveolin-2 [Caenorhabditis elegans] |
| GI:392921545 | SwissProt | Q18879.3 | 351 | RecName: Full=Caveolin-2 [Caenorhabditis elegans] |
| GI:392921547 | SwissProt | Q18879.3 | 351 | RecName: Full=Caveolin-2 [Caenorhabditis elegans] |