Gene/Proteome Database (LMPD)
Proteins
| Protein T12B3.3 | |
|---|---|
| Refseq ID | NP_501176 |
| Protein GI | 17542344 |
| UniProt ID | Q9UAW8 |
| mRNA ID | NM_068775 |
| Length | 356 |
| RefSeq Status | REVIEWED |
| MAGFSLEESAVKILGVTIAVIGAIYLIYPPGLLLIPLSLFIFSYTTKNEKCSSKNVDTFFSGFKIGGHRGAPKSFPENSMAGFAQAKADGADLIEFDVALTKDGKAVLMHDDDLDRTTDMKGPIRDKTRAELDRCDISATFKRTAPGDHCRLATVSRERVPDMEDVVKWAVENNTRMLFDVKDSDNELVDQIANLFQKYNLYDKAIVCSFFPWVVYRIKKGDQKILTGLTWRLKFWSYHDIENIRPRYSGPKQMLFEMIDVAHVWLLKKVTPWYLGADLLLTNNLDISQALIMDQRRRGMRVAVWTVNDMAEMHWMLKTLNIPILTDYPELTTQAAHLEELQKRDYMPMHKSSSDL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008889 | IEA:InterPro | F | glycerophosphodiester phosphodiesterase activity |
| GO:0006071 | IEA:InterPro | P | glycerol metabolic process |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008226 (as displayed in Record Overview)
Identical Sequences to LMP008226 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17542344 | EMBL | CCD67577.1 | 356 | Protein T12B3.3 [Caenorhabditis elegans] |
Related Sequences to LMP008226 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17542344 | EMBL | CAP26485.1 | 356 | Protein CBG05849 [Caenorhabditis briggsae] |
| GI:17542344 | GenBank | EFO93841.1 | 356 | hypothetical protein CRE_12704 [Caenorhabditis remanei] |
| GI:17542344 | GenBank | EFP09946.1 | 364 | hypothetical protein CRE_11549 [Caenorhabditis remanei] |
| GI:17542344 | RefSeq | XP_002633148.1 | 356 | Hypothetical protein CBG05849 [Caenorhabditis briggsae] |
| GI:17542344 | RefSeq | XP_003090200.1 | 364 | hypothetical protein CRE_11549 [Caenorhabditis remanei] |
| GI:17542344 | RefSeq | XP_003107942.1 | 356 | hypothetical protein CRE_12704 [Caenorhabditis remanei] |