Gene/Proteome Database (LMPD)

LMPD ID
LMP008150
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein MECR-1
Gene Symbol
Synonyms
CELE_W09H1.5
Alternate Names
Protein MECR-1
Chromosome
II
EC Number
1.3.1.38

Proteins

Protein MECR-1
Refseq ID NP_496800
Protein GI 17536829
UniProt ID O45903
mRNA ID NM_064399
Length 344
RefSeq Status REVIEWED
MLKVLSLRSALQRAASTRQLVYEGYRNPPEAIQLKTVTIADKPSADQVLVQWIAAPINPADLNQIQGVYPVKPALPAVGGNEGFGKVISVGSNVSSIKVGDHVIPDRSGLGTWRELGLHQENDLFPIDNTLSMEYAATFQVNPPTAYRMLKDFIDLKKGDTVAQNGANSAVGKHVIQICRILGIKTVNVVRSRDNLEELVKELKDLGADEVITQEELYSRKKKFPGVKLALNCVGGRSSLFLASLLDHGGCMVTYGGMSKQPVDCPTGPLIFKDISLRGFWMSRWYDIQKSPEKRHEMYQELAGWMKSGEIKKQEIVKNRLEDHAKALDTALSKFDKKQFFVLE

Gene Information

Entrez Gene ID
Gene Name
Protein MECR-1
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0019166 IEA:UniProtKB-EC F trans-2-enoyl-CoA reductase (NADPH) activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
cel_M00085 Fatty acid biosynthesis, elongation, mitochondria
cel00062 Fatty acid elongation
cel01212 Fatty acid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR013154 Alcohol dehydrogenase GroES-like
IPR002085 Alcohol dehydrogenase superfamily, zinc-type
IPR013149 Alcohol dehydrogenase, C-terminal
IPR011032 GroES (chaperonin 10)-like
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
Protein MECR-1
Protein Entry
MECR1_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + NADP(+) = trans-2,3-dehydroacyl-CoA + NADPH.
Function Oxidoreductase with a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2- decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16). May play a role in mitochondrial fatty acid synthesis (By similarity). {ECO:0000250}.
Similarity Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. {ECO:0000305}.
Subcellular Location Mitochondrion {ECO:0000250}.
Subunit Homodimer. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008150 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17536829 RefSeq NP_496800 344 Protein MECR-1

Identical Sequences to LMP008150 proteins

Reference Database Accession Length Protein Name
GI:17536829 EMBL CAB04958.1 344 Protein MECR-1 [Caenorhabditis elegans]
GI:17536829 SwissProt O45903.1 344 RecName: Full=Probable trans-2-enoyl-CoA reductase 1, mitochondrial; Flags: Precursor [Caenorhabditis elegans]

Related Sequences to LMP008150 proteins

Reference Database Accession Length Protein Name
GI:17536829 EMBL CAP23774.2 344 Protein CBR-MECR-1 [Caenorhabditis briggsae]
GI:17536829 EMBL CDJ82901.1 343 Alcohol dehydrogenase GroES and Alcohol dehydrogenase domain containing protein [Haemonchus contortus]
GI:17536829 GenBank EFO86035.1 344 CRE-MECR-1 protein [Caenorhabditis remanei]
GI:17536829 GenBank EGT36043.1 344 CBN-MECR-1 protein [Caenorhabditis brenneri]
GI:17536829 RefSeq XP_002631052.1 423 Hypothetical protein CBG02814 [Caenorhabditis briggsae]
GI:17536829 RefSeq XP_003117169.1 344 CRE-MECR-1 protein [Caenorhabditis remanei]