Gene/Proteome Database (LMPD)
Proteins
| Protein GPDH-1 | |
|---|---|
| Refseq ID | NP_493454 |
| Protein GI | 17507425 |
| UniProt ID | Q9XTS4 |
| mRNA ID | NM_061053 |
| Length | 374 |
| RefSeq Status | REVIEWED |
| MPCQNFDYSYNFNNNSGEDYRKKIAIVGGGNWGSAIACVVGKTVKAQDEVFQPIVSIWCRDSRKPGDLSPSIAETINSTHENPKYLPGRRIPDNVVATSSLLEACQSAHILILVVPHQGIPQICDELRGKLQKGAHAISLTKGISSSCENGEIKMQLISEDIERALGVQCSVLMGANLAGEVADGKFCEATIGCKSLKNGEELKKVFDTPNFRIRVTTDYEAVELCGALKNIVACAAGFADGLGWAYNVKSAIIRLGLLETKKFVEHFYPSSVGHTYFESCGVADLITTCYGGRNRKVAEAFIKSDKPLRVIEQELLKGQSAQGPPTAQDVYEMLEINEISEKFPIFASVHKVFTGHHGEQELYDSLRNHPEYD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009331 | IEA:InterPro | C | glycerol-3-phosphate dehydrogenase complex |
| GO:0051287 | IEA:InterPro | F | NAD binding |
| GO:0004367 | IEA:InterPro | F | glycerol-3-phosphate dehydrogenase [NAD+] activity |
| GO:0004368 | ISS:WormBase | F | glycerol-3-phosphate dehydrogenase activity |
| GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
| GO:0046168 | IEA:InterPro | P | glycerol-3-phosphate catabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008927 | 6-phosphogluconate dehydrogenase, C-terminal-like |
| IPR013328 | Dehydrogenase, multihelical |
| IPR006168 | Glycerol-3-phosphate dehydrogenase, NAD-dependent |
| IPR006109 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, C-terminal |
| IPR011128 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, N-terminal |
| IPR017751 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, eukaryotic |
| IPR016040 | NAD(P)-binding domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | sn-glycerol 3-phosphate + NAD(+) = glycerone phosphate + NADH. |
| Similarity | Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008117 (as displayed in Record Overview)
Identical Sequences to LMP008117 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17507425 | EMBL | CAB16310.1 | 374 | Protein GPDH-1 [Caenorhabditis elegans] |
| GI:17507425 | GenBank | ABZ31360.1 | 374 | Sequence 5298 from patent US 7314974 |
Related Sequences to LMP008117 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17507425 | EMBL | CAP36214.1 | 374 | Protein CBR-GPDH-1 [Caenorhabditis briggsae] |
| GI:17507425 | GenBank | EFP03314.1 | 378 | CRE-GPDH-1 protein [Caenorhabditis remanei] |
| GI:17507425 | GenBank | EGT32474.1 | 377 | CBN-GPDH-1 protein [Caenorhabditis brenneri] |
| GI:17507425 | RefSeq | XP_002646459.1 | 374 | C. briggsae CBR-GPDH-1 protein [Caenorhabditis briggsae] |
| GI:17507425 | RefSeq | XP_003113124.1 | 395 | CRE-GPDH-2 protein [Caenorhabditis remanei] |
| GI:17507425 | RefSeq | XP_003115179.1 | 378 | CRE-GPDH-1 protein [Caenorhabditis remanei] |