Gene/Proteome Database (LMPD)
Proteins
| Protein DAF-36 | |
|---|---|
| Refseq ID | NP_505629 |
| Protein GI | 71983709 |
| UniProt ID | Q17938 |
| mRNA ID | NM_073228 |
| Length | 428 |
| RefSeq Status | REVIEWED |
| MLLEQIWGFLTAHPISVVTTILIVYLIHITLKPLNRVRRLGDVGLFFGKPELKGFYRERQLERLKLLRRVGDMPPVFPNGWYCVCESEKLANNQIMEITVLGQFLSLIRSESGAVYITDSYCPHIGANFNIGGRVVRDNCIQCPFHGWIFSAETGKCVEVPYDEGRIPEQAKVTTWPCIERNNNIYLWYHCDGAEPEWEIPEITEITDGFWHLGGRTEHEVMCHIQEIPENGADIAHLNYLHKSAPPVTKGSDIIKTDLSDPQPAVQHVWDGKWEVKSEEDRHCGVMHLNQFMTFWGYKVPLTSSKLVAEQHGPGIVHMLFDFGIWGKGVVFQTVTPEEALLQRVRFRIFSNIPWFFVKFFMTVEAMQFERDVFIWSNKKYIKSPLLVKNDGPIQKHRRWFSQFYTENSPKMLKDGSLSNQAKSIFDW | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:WormBase | C | cytoplasm |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0051537 | IEA:UniProtKB-KW | F | 2 iron, 2 sulfur cluster binding |
| GO:0047598 | IEA:UniProtKB-EC | F | 7-dehydrocholesterol reductase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0008203 | IEA:UniProtKB-KW | P | cholesterol metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR017941 | Rieske [2Fe-2S] iron-sulphur domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Cholesterol + NADP(+) = cholesta-5,7-dien-3- beta-ol + NADPH. {ECO:0000269|PubMed:21632547, ECO:0000269|PubMed:21749634}. |
| Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence={ECO:0000255|PROSITE-ProRule:PRU00628}; Note=Binds 1 [2Fe-2S] cluster per subunit. {ECO:0000255|PROSITE- ProRule:PRU00628}; |
| Function | Catalyzes the production of 7-dehydrocholesterol (7-DHC) by the desaturation of the C7-C8 single bond of cholesterol. This reaction is the first step in the synthesis of the steroid hormone delta(7)-dafachronic acid. Dafachronic acids bind directly to the nuclear hormone receptor (NHR) daf-12, suppressing dauer formation and inducing reproductive growth. {ECO:0000269|PubMed:16563875, ECO:0000269|PubMed:21632547, ECO:0000269|PubMed:21749634}. |
| Pathway | Steroid hormone biosynthesis; dafachronic acid biosynthesis. {ECO:0000269|PubMed:21632547, ECO:0000269|PubMed:21749634}. |
| Similarity | Contains 1 Rieske domain. {ECO:0000255|PROSITE- ProRule:PRU00628}. |
| Subcellular Location | Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Expressed in intestine at all postembryonic stages, including dauer. Expression is reduced in daf-2 mutants. {ECO:0000269|PubMed:16563875}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008017 (as displayed in Record Overview)
Identical Sequences to LMP008017 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71983709 | EMBL | CAA98235.2 | 428 | Protein DAF-36 [Caenorhabditis elegans] |
| GI:71983709 | SwissProt | Q17938.2 | 428 | RecName: Full=Cholesterol desaturase daf-36 [Caenorhabditis elegans] |
Related Sequences to LMP008017 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71983709 | EMBL | CAP29052.2 | 430 | Protein CBR-DAF-36 [Caenorhabditis briggsae] |
| GI:71983709 | GenBank | EFO99512.1 | 428 | CRE-DAF-36 protein [Caenorhabditis remanei] |
| GI:71983709 | GenBank | EFP10952.1 | 445 | hypothetical protein CRE_30692 [Caenorhabditis remanei] |
| GI:71983709 | RefSeq | XP_002637057.1 | 428 | C. briggsae CBR-DAF-36 protein [Caenorhabditis briggsae] |
| GI:71983709 | RefSeq | XP_003105594.1 | 428 | CRE-DAF-36 protein [Caenorhabditis remanei] |
| GI:71983709 | RefSeq | XP_003112431.1 | 445 | hypothetical protein CRE_30692 [Caenorhabditis remanei] |