Gene/Proteome Database (LMPD)
Proteins
| Protein ELO-1 | |
|---|---|
| Refseq ID | NP_501689 |
| Protein GI | 17540774 |
| UniProt ID | G5EEE5 |
| mRNA ID | NM_069288 |
| Length | 288 |
| RefSeq Status | REVIEWED |
| MAQHPLVQRLLDVKFDTKRFVAIATHGPKNFPDAEGRKFFADHFDVTIQASILYMVVVFGTKWFMRNRQPFQLTIPLNIWNFILAAFSIAGAVKMTPEFFGTIANKGIVASYCKVFDFTKGENGYWVWLFMASKLFELVDTIFLVLRKRPLMFLHWYHHILTMIYAWYSHPLTPGFNRYGIYLNFVVHAFMYSYYFLRSMKIRVPGFIAQAITSLQIVQFIISCAVLAHLGYLMHFTNANCDFEPSVFKLAVFMDTTYLALFVNFFLQSYVLRGGKDKYKAVPKKKNN | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006636 | IMP:WormBase | P | unsaturated fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007990 (as displayed in Record Overview)
Identical Sequences to LMP007990 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17540774 | GenBank | AEW32717.1 | 288 | Sequence 14 from patent US 8071341 |
| GI:17540774 | GenBank | AFK97125.1 | 288 | Sequence 14 from patent US 8158392 |
| GI:17540774 | GenBank | AFL61018.1 | 288 | Sequence 14 from patent US 8106226 |
| GI:17540774 | GenBank | AFL64476.1 | 288 | Sequence 23 from patent US 8188335 |
| GI:17540774 | GenBank | AGB67173.1 | 288 | Sequence 14 from patent US 8288572 |
| GI:17540774 | GenBank | AHE22351.1 | 288 | Sequence 14 from patent US 8575377 |
Related Sequences to LMP007990 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17540774 | EMBL | CAP37153.1 | 290 | Protein CBR-ELO-1 [Caenorhabditis briggsae] |
| GI:17540774 | GenBank | EFO93522.1 | 298 | CRE-ELO-1 protein [Caenorhabditis remanei] |
| GI:17540774 | GenBank | EGT49975.1 | 289 | hypothetical protein CAEBREN_18391 [Caenorhabditis brenneri] |
| GI:17540774 | GenBank | EGT58239.1 | 289 | CBN-ELO-1 protein [Caenorhabditis brenneri] |
| GI:17540774 | RefSeq | XP_002633945.1 | 290 | C. briggsae CBR-ELO-1 protein [Caenorhabditis briggsae] |
| GI:17540774 | RefSeq | XP_003093632.1 | 298 | CRE-ELO-1 protein [Caenorhabditis remanei] |