Gene/Proteome Database (LMPD)

LMPD ID
LMP007937
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein TTM-5
Gene Symbol
Synonyms
CELE_Y54E5A.1
Alternate Names
Protein TTM-5
Chromosome
I
EC Number
1.-.-.-

Proteins

Protein TTM-5
Refseq ID NP_493549
Protein GI 17510269
UniProt ID G5EC63
mRNA ID NM_061148
Length 362
RefSeq Status REVIEWED
MGQSVSRDDFIWTLTEQPHMSRREEIVKKYPEVKKLFGVDPSLKYVVSSLVIFQIFMCWLLQDADWILIILEAYFCGGIINHAMTLAIHDISHNTAFGNKYPLKNRFFGMWANLPIAVPISVSFKKYHVEHHRYLGEDGLDTDVPTTFEAEFFTTAPRKLLWLALQPFFYGFRPLIIYKKAPTDMEILNAIIQISFDLLILHFFGVKSLFYLLFGTIISMGLHPSAGHFISEHYAFKEDQETFSYYGLWNLCTFNVGYHVEHHDFPYIPGRDLPKLRAMAPEYYENLLKHTSMMQILTEFVVNPAMGPYARLKRKPRVAQEFYGNYQLFEYVEGFLHHIGVYRLQKFAVNVFDLNNNSKKLN

Gene Information

Entrez Gene ID
Gene Name
Protein TTM-5
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0030148 IEA:InterPro P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5653216 Sphingolipid de novo biosynthesis
5653217 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR011388 Sphingolipid delta4-desaturase
IPR013866 Sphingolipid delta4-desaturase, N-terminal

UniProt Annotations

Entry Information

Gene Name
Protein TTM-5
Protein Entry
DEGS2_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Function Bifunctional enzyme which acts as both a sphingolipid delta(4)-desaturase and a sphingolipid C4-hydroxylase. {ECO:0000250}.
Pathway Lipid metabolism; sphingolipid metabolism.
Similarity Belongs to the fatty acid desaturase family. DEGS subfamily. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007937 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17510269 RefSeq NP_493549 362 Protein TTM-5

Identical Sequences to LMP007937 proteins

Reference Database Accession Length Protein Name
GI:17510269 EMBL CAA21659.2 362 Protein TTM-5 [Caenorhabditis elegans]
GI:17510269 SwissProt G5EC63.1 362 RecName: Full=Putative sphingolipid delta(4)-desaturase/C4-hydroxylase [Caenorhabditis elegans]

Related Sequences to LMP007937 proteins

Reference Database Accession Length Protein Name
GI:17510269 EMBL CAP28528.1 362 Protein CBR-TTM-5 [Caenorhabditis briggsae]
GI:17510269 EMBL CDJ80529.1 362 Sphingolipid delta4-desaturase and Fatty acid desaturase domain containing protein [Haemonchus contortus]
GI:17510269 GenBank EFO83785.1 364 hypothetical protein CRE_14245 [Caenorhabditis remanei]
GI:17510269 GenBank EGT57597.1 364 hypothetical protein CAEBREN_32097 [Caenorhabditis brenneri]
GI:17510269 RefSeq XP_002640639.1 362 Hypothetical protein CBG08757 [Caenorhabditis briggsae]
GI:17510269 RefSeq XP_003097715.1 364 hypothetical protein CRE_14245 [Caenorhabditis remanei]