Gene/Proteome Database (LMPD)

LMPD ID
LMP007896
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein ACL-1
Gene Symbol
Synonyms
CELE_F59F4.4
Chromosome
X
EC Number
2.3.1.51

Proteins

Protein ACL-1
Refseq ID NP_510606
Protein GI 17568319
UniProt ID Q93841
mRNA ID NM_078205
Length 262
MTFLAILFVIAVLLLLAQLPVIGFYIRAVYFGMCLIIGGFLGGLASIPFGKSPNNHFRMFKIFQAMTWPMGVRFELRNSEILHDKKPYIIIANHQSALDVLGMSFAWPVDCVVMLKSSLKYLPGFNLCAYLCDSVYINRFSKEKALKTVDTTLHEIVTKKRKVWIYPEGTRNAEPELLPFKKGAFILAKQAKIPIVPCVFSSHKFFYSHAEKRLTSGNCIIDILPEVDSSKFDSIDDLSAHCRKIMQAHREKLDAEAANLNI

Gene Information

Entrez Gene ID
Gene Name
Protein ACL-1
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003841 IEA:UniProtKB-EC F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
cel00561 Glycerolipid metabolism
ko00561 Glycerolipid metabolism
cel00564 Glycerophospholipid metabolism
ko00564 Glycerophospholipid metabolism
cel01100 Metabolic pathways
M00089 Triacylglycerol biosynthesis
cel_M00089 Triacylglycerol biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5652529 Fatty acid, triacylglycerol, and ketone body metabolism
5652685 Glycerophospholipid biosynthesis
5652491 Metabolism
5652530 Metabolism of lipids and lipoproteins
5652686 Phospholipid metabolism
5652684 Synthesis of PA
5652675 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR004552 1-acyl-sn-glycerol-3-phosphate acyltransferase
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
Protein ACL-1
Protein Entry
PLC1_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}.
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. {ECO:0000250}.
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}.
Subcellular Location Membrane ; Multi-pass membrane protein .
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007896 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17568319 RefSeq NP_510606 262 Protein ACL-1

Identical Sequences to LMP007896 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007896 proteins

Reference Database Accession Length Protein Name