Gene/Proteome Database (LMPD)

LMPD ID
LMP007887
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein HYL-2
Gene Symbol
Synonyms
CELE_K02G10.6
Alternate Names
Protein HYL-2
Chromosome
X
EC Number
2.3.1.24

Proteins

Protein HYL-2
Refseq ID NP_508803
Protein GI 86565001
UniProt ID Q7Z139
mRNA ID NM_076402
Length 329
RefSeq Status REVIEWED
MPWWTDALYWLPRGVSWSDMYNKTTEPGYMYPHYSHLWMTVLTGISLIIYRFVFENYIFVPLAHFLSRKNPPETRRGTLDREKKYSRMAECAMRALYYTISFVCGLYLVLHESHLYDITECWRNWPFHPIPNAVAWYYWIQGGFYIALVFGILFLDAKRSDFWQMLVHHFITLALIGVSWTMNMVRVGTLILVSHDAVDILIDVGKILRYEQFETALTICFAGVLFVWVATRLVYYPFWIIRSVWFDAPALIQDDYEWLNFDQQPQAPRFIMLLLTALLILHIFWAYILFKIAYDTIQEGVVDDVREDFDEQSLVNREKAKQQNKNKDD

Gene Information

Entrez Gene ID
Gene Name
Protein HYL-2
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0050291 IEA:UniProtKB-EC F sphingosine N-acyltransferase activity
GO:0006665 IEA:UniProtKB-UniPathway P sphingolipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5653216 Sphingolipid de novo biosynthesis
5653217 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR016439 Longevity assurance, LAG1/LAC1
IPR006634 TRAM/LAG1/CLN8 homology domain

UniProt Annotations

Entry Information

Gene Name
Protein HYL-2
Protein Entry
HYL2_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + sphingosine = CoA + N- acylsphingosine. {ECO:0000269|PubMed:19372430}.
Function Catalyzes the acylation of sphingosine to form ceramides. Exhibits substrate preference for fatty acyl-coA chains containing 20 and 22 carbons. Required for adaptation of the nematode to anoxia. Anoxia tolerance may require one or more of the ceramide species that are either specifically or preferentially synthesized by hyl-2, and seems to be effected by a pathway that is parallel to that involving daf-2. {ECO:0000269|PubMed:19372430}.
Pathway Lipid metabolism; sphingolipid metabolism. {ECO:0000269|PubMed:19372430}.
Similarity Belongs to the sphingosine N-acyltransferase family. {ECO:0000305}.
Similarity Contains 1 TLC (TRAM/LAG1/CLN8) domain. {ECO:0000255|PROSITE-ProRule:PRU00205}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007887 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
86565001 RefSeq NP_508803 329 Protein HYL-2

Identical Sequences to LMP007887 proteins

Reference Database Accession Length Protein Name
GI:86565001 EMBL CCD68564.1 329 Protein HYL-2 [Caenorhabditis elegans]
GI:86565001 SwissProt Q7Z139.1 329 RecName: Full=Ceramide synthase hyl-2 [Caenorhabditis elegans]

Related Sequences to LMP007887 proteins

Reference Database Accession Length Protein Name
GI:86565001 EMBL CAP33018.2 329 Protein CBR-HYL-2 [Caenorhabditis briggsae]
GI:86565001 GenBank EFO82982.1 329 CRE-HYL-2 protein [Caenorhabditis remanei]
GI:86565001 GenBank EGT30008.1 329 CBN-HYL-2 protein [Caenorhabditis brenneri]
GI:86565001 PIR - 368 hypothetical protein K02G10.6 - Caenorhabditis elegans [Caenorhabditis elegans]
GI:86565001 RefSeq XP_002644579.1 425 C. briggsae CBR-HYL-2 protein [Caenorhabditis briggsae]
GI:86565001 RefSeq XP_003118384.1 329 CRE-HYL-2 protein [Caenorhabditis remanei]