Gene/Proteome Database (LMPD)
Proteins
| Protein COQ-3, isoform a | |
|---|---|
| Refseq ID | NP_001041045 |
| Protein GI | 115533050 |
| UniProt ID | O18235 |
| mRNA ID | NM_001047580 |
| Length | 268 |
| RefSeq Status | REVIEWED |
| MIPSRSARIIAKLQRLHSTTSAASVSSIDVKEVEKFGDLSAEWADELGPFHALHSLNRIRVPWIVDNVRKSDQKAPPRLVDVGSGGGLLSIPLARSGFDVTGIDATKQAVEAANQSLTAKPLQIAGISKRLRFEHTSVEDFCQKPHNKSAYDAVVASEIVEHVADLPGFIGCLAELARPGAPLFITTINRTWLSKLAAIWLAENVLKIVPPGVHDWEKFITPAELTSHLEKAGCRVTAVHGLMFHPVGNHWTWIESTQCNYGILAVKN | |
| Protein COQ-3, isoform b | |
|---|---|
| Refseq ID | NP_001076737 |
| Protein GI | 133930347 |
| UniProt ID | O18235 |
| mRNA ID | NM_001083268 |
| Length | 41 |
| RefSeq Status | REVIEWED |
| MQSSLRKLSNTSPIFPDSLAASLSWLAPVPRSSSQLSTERG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031314 | ISS:WormBase | C | extrinsic component of mitochondrial inner membrane |
| GO:0005743 | ISS:WormBase | C | mitochondrial inner membrane |
| GO:0008425 | IEA:InterPro | F | 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity |
| GO:0008168 | ISS:WormBase | F | methyltransferase activity |
| GO:0032259 | ISS:GOC | P | methylation |
| GO:0002119 | IMP:WormBase | P | nematode larval development |
| GO:0006744 | IMP:WormBase | P | ubiquinone biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP007874 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 115533050 | RefSeq | NP_001041045 | 268 | Protein COQ-3, isoform a |
| 133930347 | RefSeq | NP_001076737 | 41 | Protein COQ-3, isoform b |
Identical Sequences to LMP007874 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:115533050 | EMBL | CAB16512.1 | 268 | Protein COQ-3, isoform a [Caenorhabditis elegans] |
Related Sequences to LMP007874 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:115533050 | EMBL | CAP38290.2 | 262 | Protein CBR-COQ-3 [Caenorhabditis briggsae] |
| GI:115533050 | EMBL | CDJ84378.1 | 427 | Complex 1 LYR protein and Methyltransferase type 11 domain containing protein [Haemonchus contortus] |
| GI:115533050 | GenBank | EFO92637.1 | 268 | CRE-COQ-3 protein [Caenorhabditis remanei] |
| GI:115533050 | GenBank | EGT45100.1 | 261 | CBN-COQ-3 protein [Caenorhabditis brenneri] |
| GI:115533050 | RefSeq | XP_002632609.1 | 255 | C. briggsae CBR-COQ-3 protein, partial [Caenorhabditis briggsae] |
| GI:115533050 | RefSeq | XP_003094022.1 | 268 | CRE-COQ-3 protein [Caenorhabditis remanei] |